KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344791
Entry
4344791           CDS       T01015                                 
Name
(RefSeq) DNA polymerase I B, mitochondrial isoform X1
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4344791
   03410 Base excision repair
    4344791
   03420 Nucleotide excision repair
    4344791
   03440 Homologous recombination
    4344791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4344791
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344791
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4344791
DNA replication proteins [BR:osa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     4344791
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     4344791
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     4344791
SSDB
Motif
Pfam: DNA_pol_A DNA_pol_A_exo1
Other DBs
NCBI-GeneID: 4344791
NCBI-ProteinID: XP_015650229
UniProt: Q6Z4T3
LinkDB
Position
8:complement(4406611..4417617)
AA seq 1035 aa
MAVAPPLPPAPARLLRRWQGSSPWLSSSFGRTRYFSRPAFAAGGRQDYSPSSGMGVSKTG
AFRLGLHGNLNVQSSVQEWVDETKRLFFLRTTNNVRNNITNGTTPLRVGNLRHDPSEDIR
SSNYPSLYNQRERGPSNSIVNRHVDTDLAKHRVMYQSAHAVPAPFSVANNDIKPLNLLDG
SKEEIPWHDSVTVESSLPKVSKSETTLVVDKAIPNKKEHKRITRKVTLNIPDKASLSTES
KNARKLLATIYDKVLVVDNVESARSVVKLLTTKYKGFIHACDTEVANIDVKEETPVGHGE
VICFSIYSGNSDGEADFGNGKTCIWVDVLDGGRDVLMEFAPFFEDPSIKKVWHNYSFDSH
VIENCGIKVAGFHADTMHLARLWDSSRRADGGYSLEGLTNDHRIMNAVLKDIHKTGKVSM
KTIFGRKNVRKNGSEGKTISIEPVKKLQREDRELWICYSSLDSMSTLKLYESLKNKLEAK
EWIFDGCPRGTMYDFYEEYWRPFGALLVKMETEGMFVDRAYLSEIEKTAVVERKLAADKF
RKWASKHCPDAKYMNVNSDNQIRQLFFGGIKNRNKPGETWPQSKAFKVPNDESIATEGKK
IPKSRTIKLFTIVEDLKLFTTEGKKTTKTGWLKVRGDVLWSLAGKIPTDHIYKIDDDGQE
FDEDGSSVELPEQDIEDTSPYGTAYEAFGGGKKGREACHAIAALCEVFSIDKLISGFIVP
LQGDHISCKEGRIHCSLNINTETGRLSARTPSLQNQPALEKDRYKIRQAFVAAPGNTLIV
ADYGQLELRILAHLTNCKSMLEAFKAGGDFHSRTAMNMYQHVRDAVEEKKVLLEWHPQPG
QDKPPVPLLKDAFGAERRKAKMLNFSIAYGKTAVGLSQDWNVEVREARDTLKLWHRDRKE
ISAWQKKQKALAFEKCEVYTLLGRSRQFPNMTHAGPGQKSHVERAAINAPVQGSAADVAM
CAMLEIERNARLKELGWRLLLQVHDEVILEGPTESAEEAKAIVVECMSKPFYGTNILKVD
LAVDAKYAKSWYAAK
NT seq 3108 nt   +upstreamnt  +downstreamnt
atggcggtggcgccgccgctgccgccggcaccggcgcggctgctccggcggtggcagggg
tcgtcgccgtggctgtcctcttccttcggccgcacccgctacttttcgcgcccggccttc
gccgcgggaggaaggcaagattattctcctagttctggcatgggggttagcaaaactggt
gctttcaggctgggattgcatggcaacttaaatgtacaaagtagcgtgcaagaatgggtt
gatgaaaccaagaggttatttttcctcaggaccaccaacaatgtcaggaacaacatcact
aatggcactactcctctgcgggttggaaatctgcgtcatgatccctcagaagatatcagg
agttcaaactatccttccttgtataatcaaagagaaagagggccatctaattcaattgta
aatagacatgtcgatacagatttggctaagcatcgtgtgatgtatcagtcagcacatgct
gtgcctgccccattcagtgttgctaataatgatatcaaaccactgaacctgcttgatggc
tccaaggaggaaattccttggcacgattccgttacggtggaatcttctctgcctaaagtt
tccaagtcagagacaactttggtggttgataaagctatcccaaacaaaaaggagcacaaa
cgcattacaaggaaagtgacgctaaatatcccggacaaagcttccttgtccactgagtca
aaaaatgcacggaagttgcttgctaccatctatgacaaagttttggttgtcgacaatgtt
gagtcagctaggagtgttgttaaattgcttactacaaagtacaaaggctttattcatgca
tgtgacacggaggtggcaaatattgatgtcaaagaagagacgccagttggtcatggagaa
gtaatatgctttagcatctattcaggaaattctgatggggaggctgattttggaaatggc
aaaacatgcatatgggtggatgtgctagatggtggaagggatgttctaatggagtttgct
cctttctttgaggacccatctatcaaaaaggtttggcataactatagttttgatagccat
gtcattgagaactgtggaatcaaggttgctggatttcatgctgatacaatgcatcttgca
cgcctgtgggattcttccaggagagctgatggtggatattcacttgaaggactaacaaat
gatcacagaatcatgaatgctgttctaaaggacatacataaaactgggaaggtgtcaatg
aaaactatttttggtcggaaaaatgttagaaaaaatggatctgaagggaaaaccatatct
atcgagccagtcaaaaagttacaaagggaggatagagagttgtggatttgctattcctca
ctagattcaatgagtacattgaagctttatgaaagcttgaaaaacaagcttgaagcaaag
gaatggattttcgatggttgtcctagaggaacaatgtatgatttctacgaagagtattgg
cgtccctttggtgctcttcttgtaaagatggaaacagagggaatgtttgttgaccgtgca
tacctttcggagattgagaaaactgctgttgttgaacgaaaattagcagcggataagttt
cggaaatgggcatctaagcattgtcctgatgccaagtacatgaatgtgaatagtgataat
caaattcgccaacttttctttggtggcatcaaaaatagaaataagcctggtgaaacttgg
ccacaaagtaaagcttttaaagtgccaaatgatgaaagcatagctacagagggcaagaag
attccaaagtctcgcacaatcaaacttttcactattgtggaagatcttaaacttttcact
acagagggcaagaagactacaaagactggctggcttaaagtccgtggggacgttttatgg
agtttggctggtaaaatacccacagatcatatatataaaattgatgatgatggccaagag
tttgatgaagatgggagcagtgtggaacttcctgagcaggatatagaagacacttcccca
tatggaactgcatatgaagcgtttggtggaggaaagaagggaagggaagcatgtcatgcc
attgctgctctatgtgaagtcttttctattgacaaattgatatccggcttcattgttcca
ttgcagggagatcatatatcatgtaaggaagggcgcattcactgttcgttaaatatcaat
actgaaacaggacgcttgtcagcaagaacaccaagcttgcagaatcaacctgctcttgaa
aaggataggtacaagattcgccaagcttttgtcgcagctccagggaacactcttattgtt
gctgattatggccaactggaactgaggatcttggcgcatcttactaattgtaaaagcatg
ctggaagctttcaaggctggtggtgactttcattctaggacagccatgaatatgtaccag
catgttcgtgatgctgttgaagaaaagaaagttctgcttgaatggcatcctcaaccaggt
caagacaaacccccagtgccattattgaaggatgcttttggcgctgagaggaggaaggcc
aaaatgctcaatttctccattgcatatgggaagactgctgttggtctatctcaggattgg
aatgttgaagttagggaagcaagggatacactcaaactttggcatagggatagaaaggaa
atttcagcttggcaaaagaagcagaaagcccttgcgtttgagaagtgcgaagtctacact
ttgctcgggcgatcacgccaatttcctaatatgactcatgcgggtcctggtcaaaagagt
cacgtcgagcgtgctgctataaatgcaccagtgcagggcagtgcagcagatgttgctatg
tgtgcaatgcttgagatagaaagaaacgctcgccttaaggagcttggttggagactccta
ttgcaggtgcatgatgaagtgatcttggaagggcctacagaatctgccgaggaggccaag
gccatcgttgtggagtgcatgtccaagcctttctatggaaccaacatcctcaaggttgac
ctagctgtcgacgccaagtacgcgaagagctggtatgctgccaagtag

DBGET integrated database retrieval system