KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344803
Entry
4344803           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM7
  KO
K12626  U6 snRNA-associated Sm-like protein LSm7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344803
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4344803
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344803
   03041 Spliceosome [BR:osa03041]
    4344803
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4344803
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4344803
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4344803
SSDB
Motif
Pfam: LSM DUF150_C Hfq
Other DBs
NCBI-GeneID: 4344803
NCBI-ProteinID: XP_015649738
UniProt: Q6ZBS1
LinkDB
Position
8:4562429..4565371
AA seq 98 aa
MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFEREQDDPLKL
SGKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFQSDGA
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtcggggcgcaaggagacggtgctggacctggccaagttcgtcgacaagggcgtccag
gtcaagctcaccggcggcaggcaagttacagggactttgaagggctatgaccagcttcta
aacttggtgcttgatgaagcggttgaatttgaaagagagcaagatgatccattgaaacta
tcagggaaaaccagacagcttggtcttattgtctgtaggggtacagcggtgatgcttgta
tcgccaaccgatggaacggacgagattgccaaccccttccaatctgatggtgcataa

DBGET integrated database retrieval system