KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345008
Entry
4345008           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4345008 isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: REPA_OB_2
Other DBs
NCBI-GeneID: 4345008
NCBI-ProteinID: XP_015649056
LinkDB
Position
8:complement(8138953..8148833)
AA seq 361 aa
MDHCIISKLEPGLGNPRICVRLSRMWNFNDPKDDTSLLHVALVLVDETEGSIAAQIFPLD
DKLFKPLLSEGKIYYLTHYIVRNCSRSYKPVSNSLAIAFTRWTVVEEYVNAPTSFPFYTY
SLKSFNQLSALLDSKDSFTDTIGVIIEVSSITFVRSRTRDGDSLKRNVFIRMQTMPLFVF
RFGETALLSFLQKWSVFSRGQSEQQIVIFVGTLVKGFKREIYLSGNSACKWYINIKCDEV
RSLRDSLATQKEPVRWLDLPWADAVRSAAEIKSIIEIKDLNPFVHKKLEFVVTVTIKKIY
GSWWYVACDRCRRTARPYGKTYRCGGGDCPATVPASPRFKLGLIAGDDTADTKFVLFGRM
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggatcattgcattatctctaagcttgagcctggtcttggcaatccgcgcatttgtgtg
cgtctttcgcgtatgtggaacttcaatgaccctaaggatgatacttctcttcttcatgta
gcacttgtattggttgatgagacggaaggcagcattgcagctcagatattcccactagat
gataaactctttaagcccctgttgtcggaaggaaagatttactacctgacacactatatt
gtgaggaattgtagcagatcctacaagccagtgagcaactctcttgctattgcattcaca
agatggactgttgttgaggagtatgtgaatgcacccaccagctttccattctacacctac
tccctgaaatctttcaaccagctcagtgcgcttcttgacagcaaagattcattcaccgat
actatcggagtcatcattgaggtttcatctattacttttgttcgatcacgtacaagggat
ggcgacagcctaaagcgcaatgtgttcatccgcatgcaaacaatgccactattcgtgttt
cgctttggggagaccgcgctactgagtttcctgcagaagtggtcggtcttctctaggggt
cagtcagaacaacaaattgtgatatttgtcggcacgttggtgaaaggattcaaaagggaa
atctacctctcaggaaattctgcttgcaagtggtacatcaatattaaatgcgatgaagtc
cgaagcttaagagatagcctggcaactcaaaaggaaccagttaggtggcttgacttaccc
tgggctgatgccgtgcgatctgctgctgagataaaatcaatcatcgagatcaaggaccta
aacccattcgtgcataagaaactcgagtttgtcgtcacagtcaccataaagaaaatatat
gggtcttggtggtacgtagcatgtgacagatgcaggaggactgcaaggccatatggaaaa
acatatcgctgtggaggtggagattgcccagcaactgtgccagcatcaccaaggttcaag
cttggtcttatagctggagatgacacagctgatacaaagtttgttctgtttggtcgtatg
gcatag

DBGET integrated database retrieval system