KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345313
Entry
4345313           CDS       T01015                                 
Name
(RefSeq) probable RNA polymerase II transcription factor B subunit 1-1 isoform X1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4345313
  09124 Replication and repair
   03420 Nucleotide excision repair
    4345313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4345313
   03400 DNA repair and recombination proteins [BR:osa03400]
    4345313
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4345313
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4345313
SSDB
Motif
Pfam: BSD PH_TFIIH Snapin_Pallidin
Other DBs
NCBI-GeneID: 4345313
NCBI-ProteinID: XP_015650974
LinkDB
Position
8:complement(15203196..15211975)
AA seq 606 aa
MGSMTIGAKYKTTLKDPGTTGVLRMNEDKFTFTPHDPRSAMKLNVDFRSIKGHKFNKVDG
SKPAPPLLNLSKDSDKGGGYMFEFDNVTNRDLSRDFVAKVLGKQQGTIPPKPNVPPENSV
TSTGEEQLSAAEMQRRMKLLQEDSELQKLHMKFVLGNILQESEFWATRKNLLEDEANKGS
KQRPGFKSAMLADVRPSADGRTNKVTFSLTTEIIHQIFAEKPAVHRAFLDFVPKKMSEKD
FWTKYFRAEYLLRTKNTVAATAEAAEDEELAIFLKNDDILAKEARLKIKRVDPTLDMEAD
AGDDYIHLPDHGIIRDGSKETIDNDGELARRTLSQDLNRHAAVVLEGRSSDVELTDTKTV
AEAIARSKKAAEPPSSSISDDTNHERLVKVARMTEIEDLQAPRSLPYAPLCIKDPREYFD
SQQANALRSLGGNNDGRHARNCRLSTDDAFDHLLGQISSIKVNGLNYPVIQSDVALKVLN
ELNEGISRSRRLNLKNPQDSLLGQIPRRTRDELMDHWAAIQELLQHFWSSYPITTSVLYN
KVQRIKDAMTQIYQKLQDIKESAQPDVRHEISQLVKPMTQALDAAFNHDLEQQQKSSKSG
NKPNGF
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggggtccatgacgatcggcgccaagtacaagaccacgctcaaggaccccggcaccacc
ggcgtcctgcgcatgaacgaggataagttcaccttcactccccatgatccacggtcagcg
atgaagctcaatgttgatttccggagcatcaaaggccacaagttcaacaaagtagatggt
agcaaaccagctccaccattactgaatctttcaaaagactctgacaagggtggaggctac
atgtttgagtttgacaatgttactaaccgcgacctatctcgtgactttgtagctaaagtt
ttaggtaagcaacaaggtacgataccgcctaaaccaaatgtgccccctgaaaattcagtt
acttcaactggtgaagaacagcttagtgctgcagaaatgcaacgtcggatgaaattgctg
caagaagatagtgaattgcagaagttacatatgaagtttgttcttggcaatattctgcaa
gaatctgaattttgggcaacaagaaagaatttacttgaggacgaagcaaataaaggatca
aaacaaaggccaggtttcaaaagtgccatgctagctgatgttaggccatcggctgatggt
cggacaaataaggttacttttagtctcactaccgagataattcatcagatatttgcagaa
aagccagctgtgcatcgagcgtttttagattttgttccaaaaaagatgtcagaaaaagat
ttttggacaaaatattttagagctgagtatcttcttaggacaaaaaatactgtggcagca
actgctgaggctgctgaagatgaagagttagccatttttctgaagaatgacgatatacta
gcaaaggaggcaaggttgaagataaaacgagtcgatccaacattagatatggaggcagat
gctggagatgactacatccatcttccggaccatggcattattcgtgatggcagtaaagag
acgattgataatgatggtgaattggccaggagaacactttcgcaggatctgaatcgccat
gctgctgttgtgcttgaaggaagatcttcagacgtggaattaactgatacgaagactgtt
gctgaagcaattgcaaggtccaagaaagctgcagaaccaccttcaagttctatttctgat
gataccaatcatgagaggttggtaaaagtggcccgcatgactgagatagaggatctacaa
gctccacggagcctcccatacgcaccactttgtataaaggatcctcgagaatattttgat
tcccaacaagcaaatgctctgagatctttaggtggcaacaatgatggaagacatgctcgt
aattgcaggctgagtacagatgatgcatttgatcatttgttgggccaaatatcttctata
aaagttaatgggttgaactatccggttattcagtctgatgtggctcttaaggttctgaat
gaattgaatgaaggaatttcacgttcaagaagacttaatcttaagaatcctcaagatagt
ctgcttggtcaaatccctcgacgcacacgagatgaacttatggatcactgggcagctatc
caggaattattgcagcatttttggtcatcatatccaataacaacttcagttctttataat
aaggttcaaagaattaaggatgcaatgacccagatatatcaaaagttgcaggatataaag
gaatcagcacaacctgatgtgagacacgaaatatctcaactagtaaagcccatgacccag
gctttggatgctgccttcaaccatgacttggagcagcagcaaaaatcatcgaaatccggg
aataagcccaatgggttttaa

DBGET integrated database retrieval system