KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345411
Entry
4345411           CDS       T01015                                 
Name
(RefSeq) NEDD8-conjugating enzyme Ubc12
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4345411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4345411
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     4345411
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4345411
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4345411
NCBI-ProteinID: XP_015648181
UniProt: Q6ZD28
LinkDB
Position
8:complement(17513107..17516096)
AA seq 183 aa
MLNLIKIKGQKKEDAANANGKPPAKKQSPGELRLHKDIAELNLPKSTRISFPNGKDDLMN
FEVTIRPDEGYYVGGKFIFTFQVPPAYPHEPPKVKCKTKVYHPNIDLEGNVCLNILREDW
KPVLNVNTIVYGLNLLFSQPNDEDPLNHEAAAVLRDNPEKFERNVQRAMAGGYVGETHFP
RCM
NT seq 552 nt   +upstreamnt  +downstreamnt
atgctaaaccttattaagataaagggtcaaaagaaggaagatgcagccaatgcaaatgga
aagcctcctgccaaaaagcaaagtccaggggagttgcgtcttcacaaagatattgctgaa
cttaaccttcctaagtcgactagaatttcttttcctaatggcaaggatgatttgatgaac
tttgaagttactattcgacctgatgagggatactatgtaggtggtaaatttatttttact
ttccaagttcctcctgcctatcctcatgaaccacccaaagtcaagtgcaagactaaggtc
tatcatcccaatattgacttggagggaaatgtctgccttaacattctgcgtgaagattgg
aagcctgtcctgaatgtcaacacgattgtatatggcttgaatcttcttttctcacaacct
aatgatgaggaccctctaaatcatgaggcggcagcagttcttcgagacaacccagaaaag
tttgagagaaatgtccagagggcaatggctggaggctatgttggtgaaacccacttccct
agatgtatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346713
Entry
4346713           CDS       T01015                                 
Name
(RefSeq) NEDD8-conjugating enzyme Ubc12
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4346713
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4346713
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     4346713
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4346713
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 4346713
NCBI-ProteinID: XP_015610865
UniProt: B9G2V4 Q69NC4
LinkDB
Position
9:9357958..9362416
AA seq 183 aa
MLNLFKIKGQKKEEAANTNGRPPAKKQSPGELRLHKDIAELNLPKKTNITFPNGKDDLMN
IEITLRPDEGYYVGGAFVFTLQVPPTYPHEPPKVKCTTKVYHPNIDLDGNVCLNILREDW
KPVLNINTIVYGLNLLFIQPNDEDPLNHDAAAVLRDDPQKFRRNVQTAMSGGYVDRVHFP
RCK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgttgaacctctttaagataaagggacagaagaaggaagaggcggcaaatacaaatggg
agacctcctgctaagaagcaaagtccaggagaattacgtctccataaagacattgctgag
cttaatcttccaaagaaaaccaacattacttttcctaatggaaaggatgatctgatgaac
attgagattactcttcggcctgacgaaggatactatgtgggtggagcttttgttttcact
ttacaagttcctcctacttaccctcacgagccgcccaaggtcaagtgcacgactaaggtt
tatcaccctaatattgacttggacggaaatgtctgcctgaatatcctgcgtgaagactgg
aagcctgtcttgaatatcaataccattgtatatggtttgaaccttcttttcattcaaccc
aatgacgaggatcccttgaaccatgatgctgcggctgtcctccgagatgacccacaaaag
ttccggaggaatgttcagacggcgatgtcgggaggctatgtcgacagggtgcattttcca
aggtgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348232
Entry
4348232           CDS       T01015                                 
Name
(RefSeq) NEDD8-conjugating enzyme Ubc12
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4348232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4348232
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     4348232
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4348232
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 4348232
NCBI-ProteinID: XP_015614963
UniProt: Q7G4N6
LinkDB
Position
10:6244539..6250080
AA seq 183 aa
MLNLIKIKDKKKEQAASAAGKAPVKKQSAGELRLHKDISELNLPKSTSISFPNGKDDLMN
FEIIVRPDEGYYLGGTFVFTFQVSPSYPHEPPKVKCKTKVYHPNIDLEGNVCLNILREDW
KPVLNINTVIYGLNLLFTQPNDEDPLNHEAAAVLRDNPKLFEANVKRAMAGGYVGQHYFP
RCA
NT seq 552 nt   +upstreamnt  +downstreamnt
atgcttaatcttatcaaaataaaggataaaaagaaagagcaggcagcaagtgctgctgga
aaggctcctgtgaagaagcaatctgctggagagctccgtcttcacaaagatattagtgag
ctaaacctacccaagagcacatcaatttcttttcccaatggcaaggatgatctgatgaat
tttgagatcatcgtccgacctgatgaaggatattacctaggtggcactttcgtctttact
tttcaagtctctccctcttatcctcatgaacctccaaaggtgaagtgcaagaccaaggta
taccatccaaatattgatttggaaggaaatgtatgcctgaacattttgcgtgaagattgg
aagcctgttctcaacatcaacactgttatttatggccttaaccttctttttacgcaacca
aacgatgaggatccgttgaaccatgaagcagcagctgtcctccgtgacaacccaaagctg
tttgaagctaatgttaaaagggcaatggccggaggctatgtgggtcaacactatttccca
agatgtgcatga

DBGET integrated database retrieval system