KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345578
Entry
4345578           CDS       T01015                                 
Name
(RefSeq) RNA-binding protein 25 isoform X1
  KO
K12822  RNA-binding protein 25
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4345578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4345578
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4345578
 Complex B
    4345578
SSDB
Motif
Pfam: PWI RRM_1
Other DBs
NCBI-GeneID: 4345578
NCBI-ProteinID: XP_015650047
UniProt: Q6ZA70
LinkDB
Position
8:complement(19913095..19919102)
AA seq 919 aa
MAAVAPPPDGLDPPPATPPTAAAGTPPLAVPATNTPPNPATTPTPLTPNPNPSPTLPPPP
MSTPPVVAPPMHSFAPSFRPLGAPPPPPPPQQVQVQVPPQYGGVPNPGYPMAQQMQPPGV
PHVMPPGAVRPPAMYAPQPGVYLQQPGAALPPGMPRYPGPYPMMRPGFPPRPMPPVGVMP
LQRPPIIPGIRGAPPVVPPTARPPTPAVTPPDKPPTAVYVGKIAPTVDNEFLLSLLRLCG
PVKSWKRTQNPSSGKPVSFGFCEFESAEGILRATRLLNKLSIDGQELVVNINDATKEYLK
KHVEEKKKAQEKTKEMEDGGGSGTTAVTGNELSKPVSDETETGTGDAGDKGNEENPKKFG
IVTEEDSKADKDVAEKISSMIEEWLKTRPPPPPPPVEQSADISSKHKNGEYSVDVTKNDS
EDKSGTGSDKRAVNETERIETGSPDKRKERERDKEKRDKDKELERHERERERERVRRDRE
KDIKYKEVERLYKERLKEWEFREREKEYQRQHEKEREKDRERERKREIMKQEDDSDEEDN
RKRRRRSSGTLEERKRRRLREKEEDLADKLREEEEIAEARRRAVELQQQADEAAAAAAAA
AVVAESATVMEVDGDDGKERDAQDKPAVVDVGNNDAFANGVDSGVNNGKDNIGDDKNMTP
GEISDTKHNTSAPAKKLGFGLIGSGKRTSVPSVFAEEDDEDNDDKRARPLVPIDYSTEEL
QAVQANSSTGQPNIVAAAEFAKRILVTKDDKSDVEKDRSWRSSDRTNQRDRDRNDQDVGR
TSDERREKTHDREKDKQDKPKSENKNILDAKQLIDMIPRTKEELFAYDINWAIYDKHELH
ERMRPWIAKKIIEFLGEEESTLVDYIVSCTKDHVQASKMLELLQSILDVEAEMFVLKMWR
MLIFEIKKVETGLSGRAKA
NT seq 2760 nt   +upstreamnt  +downstreamnt
atggccgccgtagcgcctcctcccgacggcctagacccgccgccggcgacgccccccacc
gccgccgcgggcaccccgccgctcgccgtccccgccaccaacacgccgccgaaccccgcg
acgactcccaccccactcacgccaaaccctaaccctagcccgacgctgcccccgcccccg
atgtccacccctccggtggtcgcgccgccgatgcactccttcgccccctcgttccgcccg
ctcggcgccccgcccccgcccccgccaccgcagcaggtgcaggtgcaggtgccgccgcag
tacggcggcgtgccgaacccggggtacccgatggcgcagcagatgcagccgccgggggtc
ccccacgtgatgccgccgggcgccgtgcggccgcccgccatgtacgcgccccagcctggc
gtgtacctccagcagccaggcgctgctcttcctcccggtatgcctcgctaccctggacca
taccctatgatgcgccctggctttccgccacgcccgatgcctccagttggtgttatgccg
cttcaacgaccaccaattattcctgggattcgtggtgcacctcctgtggttccccctact
gcccgaccacctactccagctgttacacctcctgacaaaccgccaactgcagtttatgtt
ggcaagattgctccaacagtggacaatgaatttctcctttcacttctccgtctttgtggc
cctgtcaagagttggaagcgtacgcagaatccaagtagtggaaagcctgtatcatttggc
ttttgtgagttcgaatctgccgaaggcatccttcgtgcaacgcggctgctcaataaattg
agcattgatggacaagaacttgtggttaacattaatgatgccaccaaagagtacctgaag
aaacatgttgaagaaaagaagaaagcacaagaaaagaccaaagaaatggaagatggaggt
ggtagtgggactactgctgtcactggaaatgaattgtcaaagcctgtttctgatgaaaca
gagacagggacaggagatgctggtgataagggcaatgaagaaaatcctaagaaatttggg
attgttacagaggaagattctaaggctgataaggatgttgctgaaaaaattagtagtatg
attgaagagtggttaaagactagaccaccaccgccacctcccccagttgaacaatctgct
gacatctcttccaaacacaagaatggagagtatagtgtagatgtgacaaaaaatgattct
gaagataagagtggcactggaagtgataaaagggcagttaatgagaccgaaaggatagaa
actgggtctcctgataagaggaaggagagagagcgtgataaggagaagcgggacaaggat
aaagaacttgaaaggcatgaacgcgagcgagagcgagaaagagtcaggagagacagagag
aaggatattaagtataaagaagtggagaggttgtacaaggagcgcctcaaggagtgggaa
tttagagagagagaaaaagaatatcaaagacaacatgagaaggaacgagaaaaggacagg
gaacgtgagcgcaaaagggagatcatgaagcaggaagatgatagtgatgaagaggacaat
aggaaaagacgacgaaggagcagtggcacacttgaagagcggaaaaggaggcggctgcgt
gaaaaggaggaagacttagcagacaaattaagggaggaggaagaaattgctgaagcaagg
aggcgagctgtagagttgcaacaacaagcggatgaagcggctgcagcggcagcggcagcg
gcagtggtggcagaatctgctacagttatggaggttgatggcgatgatggaaaggaaaga
gatgcacaagacaaaccagctgttgtggatgttggtaacaatgatgcctttgctaatggt
gttgattccggtgttaataatggtaaagataacattggtgatgacaaaaacatgacacct
ggtgaaatttcggataccaagcataataccagtgctccagcaaagaaacttggttttggt
ctgattggctctggcaagcggacatctgtaccttcagtttttgctgaagaggatgacgaa
gataatgatgataagcgggcaagacctttagttcctattgattactcaacagaggaactg
caagctgttcaggccaattcttctactggccaaccaaatattgtagcagctgctgaattt
gccaagcgcatattggtaacaaaggatgataaatctgatgttgagaaggataggagttgg
agatcaagtgatagaacgaaccaaagggatagagatagaaatgatcaagatgttggtcgc
accagtgatgagagaagggaaaagacacatgaccgagagaaagataagcaagataagcca
aagtctgagaacaagaatattttggatgcaaaacaattaattgacatgattccgaggaca
aaggaagagctttttgcctatgatattaattgggcgatatatgacaagcatgagttgcat
gagagaatgaggccctggattgcaaagaagattattgaatttctgggtgaggaagaatca
actttggtggattacatcgtctcatgcaccaaagaccatgtccaggcatcaaaaatgttg
gagcttctacagtcaatcctggacgttgaagctgaaatgtttgtccttaagatgtggagg
atgcttatatttgagatcaagaaagtcgaaacaggactatcagggagagcaaaggcatga

DBGET integrated database retrieval system