KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345619
Entry
4345619           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD4
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4345619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4345619
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      4345619
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core
Other DBs
NCBI-GeneID: 4345619
NCBI-ProteinID: XP_015649899
UniProt: Q0J5K8 Q7EY71
LinkDB
Position
8:20559021..20566218
AA seq 880 aa
MRTRSQRDGHHAAAAAETPPSGASGGSGGDVARGGGTPRRRRRASPAAEKGKSPAKVEME
SALEDKSKNVKVHAEGYDDAGMTRFGRDGSEKNSLEEEDPDAADMDWEEGIVFAAEHDEC
YSHELGETVTVEFTDLPSSTEKKTARRLTAEEKELAELVHRVHLLCLLARGRVIDKACND
PLIQASILSVLPQHVLRNSVDTPILKANELRSLVSWFHNTFSVIAQSDDKGSFKSNLAFA
LQSYVGTAEEVCALSVALFRALNLTARFVANLDVAGLKPDTKSMGTSNQDEPRLCTKALP
SSSFVAGHNEYNNLSPVLSQNNTEGSINTTPKQVKVQGCRKSLSKKLSKCKANQRDSSAS
LSKDSSSSSQYPSTSSNAEVPRRKGDLEFELQLEMALLASAAKSQDNKLATQLNQSTDSL
LSSTPPLKKLRKSEEASSNSSVVWSRNRAPLFWAEVFCGGEASSGRWVHVDVANDIIDGE
QKVEAASAVCRKPLRYVVAFAGNGAKDVTRRYCLQWHRIVQGRVNPEWWKSVLAPLERLE
LAATNNTEEMELQTRALTEPLPTNQQAYKDHHLYALEKWLHKNQVLHPKGPVLGFCKGNP
VYPRSCVQTLQSRHGWLREGLQVRENELPAKVVTRPKRTFNSQSIQSNSNSNEDGLKPTM
ELYGKWQLEPLQLPHAVNGIVPKNERGQVDVWSEKCLPPGTVHLRLPRIFQVAKRLGIDF
APAMVGFDYRNTRCLPVFDGIVVCSEFKNTILEAYAEQEERRQAEERKQEEAQALIRWYQ
LLCSVVTTQRLKDSYKAPSSEHGPEGPSQDVSQQKGTRKSRSSETKTRSSRLQADRPFDS
PFPVHDHEHEYPEEDQSFDEETFVRTKRCPCGFSIQVEEL
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgcggaccaggagccagcgcgacggccaccacgccgccgccgctgccgaaaccccgcct
tccggggcaagcggaggatcaggaggggacgttgcgaggggcggtggcacgcctcgccgt
cgccggagggcttcgccggccgcggagaaagggaagtcgcccgccaaggtggaaatggaa
tcggcattggaggataaaagtaaaaacgttaaggtccatgcagagggttatgacgatgcc
gggatgacgaggttcggtagggatggctctgaaaagaacagtttggaggaagaagatcca
gatgcagctgatatggactgggaagaagggattgttttcgcggcggaacacgatgagtgt
tattcccatgagcttggagagacagtcaccgttgagttcactgatctaccctcttccact
gaaaagaagactgctcggaggcttactgctgaagaaaaggagttggctgaactcgtgcac
agggtccatttgctttgcctactagcaaggggtagggtaattgacaaggcttgcaatgat
cctctgattcaggcttcaattctctctgttttaccacaacatgtactacggaattctgta
gacactccaattctgaaagctaatgaactgcgtagtcttgtgagctggttccacaacact
ttcagtgtaattgcacaatccgacgacaaggggtcttttaaatcaaatttggcatttgct
cttcaaagttatgtaggcactgctgaagaggtttgtgcactttcagtggcattgtttagg
gctctcaacttaacagctaggtttgttgcgaatctggatgttgctggtctcaagcctgac
actaaatcaatggggacatcaaatcaggatgaacctaggctttgtacaaaggcgctgcca
tctagttcttttgttgcaggccataatgagtataataacctttcacctgtcctgtcacaa
aacaatactgaaggtagcatcaatacaactccaaaacaagtcaaagttcaaggctgcagg
aaaagtttgtctaaaaaattgtcgaagtgcaaggcaaatcagagagatagctctgcatca
ctatcaaaagatagctcatccagcagccaatatccttccacctccagtaatgctgaagta
ccaagacgaaaaggggatttggaatttgagttgcagctggaaatggctcttttagcatct
gcagctaaaagtcaagacaacaagctagcaactcaattaaatcagtcaactgatagctta
ctaagttcaactccaccattgaagaagttacgaaaaagtgaagaagcctcaagcaactcg
agcgtggtttggtcgaggaatagagcaccgttattttgggctgaggtattttgtggtggc
gaggcatcgtctggaagatgggtccatgttgatgttgcaaatgatattattgatggtgaa
caaaaagtagaagctgcttccgctgtttgcaggaagcctttgagatatgttgttgccttt
gctggaaatggtgctaaagatgtgaccagaaggtattgcctgcaatggcacagaattgtt
caggggagagtgaatcctgagtggtggaaaagtgttttggcacccctagagcgtcttgaa
ttggcagcaacgaacaacactgaagaaatggaacttcagaccagggccttaacagagcct
cttcctaccaatcaacaggcctacaaagaccatcatctatatgcccttgagaagtggctt
cacaagaaccaagttcttcaccccaaaggcccagtgcttggcttctgtaaagggaatcct
gtttatcctagatcttgtgttcagacactgcaatcaagacatggatggttgcgggagggt
ctgcaagtcagagaaaatgagttgcctgcaaaggtcgtgacgcggccaaagaggactttc
aattctcagtcaattcaatctaatagtaatagtaatgaagatgggcttaagccaaccatg
gaactatatggtaaatggcagctggaaccgctgcaacttccccatgcagtaaatggtatt
gtaccaaagaatgagcgtggtcaagtcgatgtgtggtcagagaaatgtcttccgcctggt
actgtacacctgaggttaccaagaatattccaggtcgcaaagagacttggaattgatttt
gccccagccatggttggatttgattatcgaaacacccggtgccttccagtttttgatgga
attgttgtctgttccgaattcaaaaatactatcttagaggcatatgcagaacaagaggaa
cggagacaagccgaggagaggaagcaggaggaagctcaggctcttattaggtggtatcag
ctgctgtgttccgtcgtaaccacacagcggttgaaggactcttacaaagcaccctcatca
gagcacggaccagaaggaccatcccaagatgttagtcagcagaagggcacacgcaaaagt
cgaagctcggaaacgaagactcgctcaagcagactacaggcggaccgaccatttgattct
ccttttcctgtccatgaccatgagcatgagtatccagaggaagatcagagcttcgacgaa
gagacgtttgtgaggacgaaacgctgtccatgtggtttttcaatccaagttgaggaattg
tag

DBGET integrated database retrieval system