KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345685
Entry
4345685           CDS       T01015                                 
Name
(RefSeq) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00131  glyceraldehyde-3-phosphate dehydrogenase (NADP+) [EC:1.2.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4345685
   00030 Pentose phosphate pathway
    4345685
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.9  glyceraldehyde-3-phosphate dehydrogenase (NADP+)
     4345685
SSDB
Motif
Pfam: Aldedh DUF5356 DUF1487
Other DBs
NCBI-GeneID: 4345685
NCBI-ProteinID: XP_015650252
UniProt: Q6Z9G0 Q0J5E6
LinkDB
Position
8:21445792..21450786
AA seq 499 aa
MAAVAGTGVFAEILEGEVYRYYADGEWRVSASGKSVAIVNPTTRLTQYRVQACTQEEVNK
VMETAKVAQKAWARTPLWKRAELLHKAAAILKEHKTPIAECLVKEIAKPAKDAISEVVRS
GDLVSYTAEEGVRILGEGKLLVSDSFPGNERNKYCLSSKVPLGVVLAIPPFNYPVNLAVS
KIGPALIAGNALVLKPPTQGAVAALHMVHCFHLAGFPKGLINCVTGKGSEIGDFLTMHPG
VNCISFTGGDTGIAISKKAGMVPLQMELGGKDACVVLEDADLDLVAANIVKGGFSYSGQR
CTAVKVVLIMESVADIVVEKVKAKLAKLTVGPPEADSDITPVVTESSANFIEGLVMDAKE
KGATFCQEYRREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNF
GLQGCVFTKDINKAIMISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINM
MTKVKSTVINLPSPSYTMG
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcggcggtggcggggacgggggtgttcgcggagatcctggagggggaggtgtacagg
tactacgccgacggggagtggcgcgtctcggcctccggcaagtccgtcgccatcgtcaac
cccaccacccgcctcacccagtacagggtgcaagcatgcacccaggaggaggtgaacaag
gtgatggagacggcgaaggtggcgcagaaggcgtgggcgcgcacgccgctgtggaagcgc
gcggagctcctgcacaaggcggccgccatcctcaaggagcacaagaccccgattgcagag
tgcctcgtcaaggagatcgccaagcctgccaaggacgcgatctctgaagtggtgaggtca
ggggatttggtgtcgtacacagctgaggagggtgttcggatactgggggaaggcaagctg
ctggtgtctgatagcttcccgggcaatgaacggaacaagtactgtttgagctccaaggta
cctcttggagtagttttggcaatcccaccatttaactatcctgtcaacctagcagtctcc
aagattggcccagcactaattgctggcaatgctcttgttctgaagcctccaactcaggga
gcggtggctgcactacatatggtgcactgcttccaccttgctggtttccccaaaggcttg
atcaattgtgtcaccgggaaaggttctgaaattggtgattttcttacgatgcatcctgga
gtcaactgcataagttttacgggaggtgatactggtatagccatttcaaagaaggctgga
atggtcccgcttcagatggaacttggaggaaaagatgcttgtgttgtgttagaggatgca
gatctggatttagtggcagcaaatatagtaaaaggaggcttctcttacagtggccagagg
tgcactgctgtgaaagtggtgctgatcatggaatccgttgctgatatcgtggtagagaag
gtgaaggccaagttggcaaaactgacagttgggccacctgaggctgactctgatatcacc
ccagttgtaacagaatcctcagcaaattttattgagggtttggtcatggatgccaaggag
aaaggagcaaccttttgtcaggagtacaggagagaaggcaaccttatctggccgttgcta
ctggatcacgtccggcctgacatgaggattgcttgggaggagccatttggccctgtcttg
cctgtgattaggatcaactcggtcgaggaaggcatccaccattgcaatgccagcaatttt
gggctgcagggatgtgtattcactaaagatatcaacaaagcgatcatgatcagcgatgcg
atggagaccggaaccgttcagatcaactctgcaccggctcgaggacctgaccatttcccc
ttccagggcttgaaggacagtgggattggatcccaggggataactaacagcataaacatg
atgaccaaggtgaagagcactgtcataaacctaccatctccatcctacaccatgggctga

DBGET integrated database retrieval system