KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345847
Entry
4345847           CDS       T01015                                 
Name
(RefSeq) signal recognition particle receptor subunit alpha
  KO
K13431  signal recognition particle receptor subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4345847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4345847
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4345847
SSDB
Motif
Pfam: SRP-alpha_N SRP54 SRP54_N AAA_22 AAA_17 AAA_16 AAA_30 MeaB MMR_HSR1 AAA_33 SPOUT_MTase
Other DBs
NCBI-GeneID: 4345847
NCBI-ProteinID: XP_015649853
UniProt: Q6Z246 Q0J4Z4
LinkDB
Position
8:complement(23717832..23722267)
AA seq 624 aa
MLEELLIFTRGGLILWSSCRALGGAALKGSPIDALIRSCLLEERSADASFSQDTYALKWT
FNNDLGLVFVAVYQRMLHLLYVDDLLAAVRKEFSQIYDPKRTSYDDAFNEVFRQLHLEAE
ARSEEMKKNKQVTGSRPTKVTTKTNRGDTQGSGGGRKKGDSGKDDSDGDSGKEHTLPNGN
SKMQENSLKDNSHARSVVVKGKENGDPNDGAFDVNKLQKMRNKGNKKNEVASNVAKNTSK
ANTKKNLKKNRVWDDTPDDKKKLDFTDPADERGDEVIDQVVVKQGESMMDKDDVVSSDSD
EEEEDGEENSGASQKKKGWFSSMFKSIAGNNVLEKSDIQPALKALKDRLMTKNVAEEIAE
KLCESVAASLEGKKLGSFTRISSTVQTAMEEALLRILTPRRSIDILRDVHAAKERGKPYV
IVFVGVNGVGKSTNLAKVAYWLLQHNLSVSLAACDTFRSGAVEQLRTHARRLQIPIFEKG
YEKDPAVVAKEAIQEATRNKSDVVLVDTAGRMQDNEPLMRALSKLINLNSPDLVLFVGEA
LVGNDAVDQLTKFNQKLADLSAVPTTRLIDGILLTKFDTIDDKVGAALSMVYISGAPVMF
VGCGQSYTDLKKLNVKSIVKTLLK
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgttggaggagctgctcatcttcacgcgcggcggcctcatcctctggtcgtcatgccgg
gcgctcggcggcgccgccctcaagggctcgcccatcgacgccctcatccgctcctgcctc
ctcgaggagcgctctgccgacgccagcttctcccaggacacctatgcgcttaagtggacc
tttaacaatgacctcggcctcgtgttcgtcgccgtttaccagcgcatgctccacctcctt
tacgtcgacgacctcctcgccgccgtccgtaaggagttctcacagatttatgatcccaag
cgcacctcctatgatgacgccttcaatgaggtttttcgccagctccacctcgaggctgag
gctcgcagtgaggagatgaagaagaataaacaggtcactggttcccggcccaccaaggtt
accactaagaccaatcgtggcgacactcagggctctggtggtggtaggaagaaaggtgac
tcggggaaggacgactctgatggtgactccgggaaggagcacactttgccaaatggtaat
tccaagatgcaagagaatagcctcaaggacaattctcatgcccgcagtgttgttgttaaa
ggaaaggagaacggagaccccaacgatggggcctttgatgtaaataagttacagaagatg
agaaacaagggtaacaagaagaatgaggttgctagtaatgtggccaagaacacctctaag
gctaacacaaagaagaatttgaagaaaaatagggtttgggatgacacacctgatgacaag
aagaagctggatttcacagacccagctgatgagagaggggatgaggtgatagaccaggtg
gttgtcaagcagggggaaagcatgatggataaggatgatgtcgtgagcagtgatagtgat
gaagaagaggaagatggagaggaaaattctggagcttcccaaaagaagaaaggatggttc
tcctcgatgttcaagagcattgcaggtaacaatgtgcttgagaagtctgacatccaacct
gcactcaaagcgcttaaagataggctgatgactaagaatgtggctgaagaaattgcagag
aaactttgtgaatcagtggcagctagccttgagggcaaaaagctgggatccttcacaagg
atatcctctactgttcagacagctatggaggaggctcttcttcgcatcttaaccccaagg
cgatctattgacatattaagggatgtacatgctgccaaagagcgtgggaagccatatgtt
attgtttttgttggagtgaatggagttggcaaatctaccaatcttgcaaaggttgcttat
tggcttcttcagcataacctcagtgtaagcctggcagcatgtgacacctttagatctggt
gctgttgagcaactgcgtactcatgctcgcaggcttcagatacctatatttgagaaggga
tatgaaaaagatccagcggttgtcgcaaaggaggctattcaggaagctactcgtaataag
tcagatgttgttcttgtcgacactgctggacgtatgcaggataatgagccactcatgaga
gcactctccaagctcatcaatctcaatagcccagatctagttttatttgttggggaagca
ttggttggtaatgatgctgttgatcaactcactaaatttaaccagaaattagcagacctt
tccgctgtccctactaccagattgatagatggcatcctgctcaccaagtttgacaccatc
gacgacaaggttggagctgcactttcaatggtttatatatctggagctccagtcatgttc
gttggctgtggtcagtcttacactgacctcaagaagctcaatgtcaaatccatcgttaaa
accctgctgaagtga

DBGET integrated database retrieval system