KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345953
Entry
4345953           CDS       T01015                                 
Name
(RefSeq) phosphoribosylglycinamide formyltransferase, chloroplastic
  KO
K00601  phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4345953
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4345953
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase 1
     4345953
SSDB
Motif
Pfam: Formyl_trans_N
Other DBs
NCBI-GeneID: 4345953
NCBI-ProteinID: XP_015649681
UniProt: Q6ZK11 A3BUJ7
LinkDB
Position
8:24731546..24734150
AA seq 290 aa
MEAAVASTGSGLRCSPNPMPKQQHERRSARVGFVSQPRPRAVRCERSPHPDARAYAAVAV
GVVAKGREVGGVGVERRRLAVFVSGGGSNFRAIHDAALGGEVNGDVVALVTDKPGCGGAE
HARGNGIPVVVFPKSKSAPEGVSIDELLNALRELRVDFILLAGYLKLIPVELVQEYPKSI
LNIHPSLLPAFGGKGYYGLKVHKAVIASGARYSGPTVHFVDEHYDTGRTLAQRVVPVLAN
DTPEQLAARVLHEEHQVYVEAVAALCDDRIVWREDGVPLIRSHTNPDEYT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggaggcggccgtcgcttccaccggctccggcctgcgctgctcgcccaatccgatgcct
aagcagcagcacgagcggcgaagtgctcgggtgggcttcgtctcccagccgcgacctcgc
gctgtccgctgcgagcggtcgccccatccggatgctcgagcctacgcggcggtggcggtg
ggggtggtggcgaaggggcgtgaggttgggggcgtcggggtggagagaaggaggctcgcg
gtgttcgtttccggtgggggatccaacttccgggcgatccacgacgccgctctgggtggg
gaggtgaatggtgatgtggttgcgttggttaccgataaaccaggctgtggaggagcggag
catgcgaggggtaatgggataccggtggttgtgttcccgaagtcgaagtctgctccagag
ggggtttctattgatgagttgttgaatgctctgagggaactcagggtagacttcattcta
cttgctggttacctgaaacttatacctgttgagctagttcaggaatatccaaaatccatt
ttgaatattcacccttcactactcccagcatttggaggcaaaggttattatggtttgaag
gtgcataaagcagtcatcgcatcaggggccaggtattcgggtccaactgtgcactttgtg
gatgagcactatgacacaggaaggactctagcccaaagggttgtacctgtgctagccaat
gatactccagagcaattggctgcaagagtccttcatgaggaacatcaggtttatgttgag
gcagttgctgccctatgtgatgaccgaattgtgtggagagaagatggtgttccacttatt
agaagtcatacaaaccctgacgagtacacttaa

DBGET integrated database retrieval system