KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345962
Entry
4345962           CDS       T01015                                 
Name
(RefSeq) serine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4345962
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4345962
   00260 Glycine, serine and threonine metabolism
    4345962
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4345962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4345962
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     4345962
    2.6.1.45  serine---glyoxylate transaminase
     4345962
    2.6.1.51  serine---pyruvate transaminase
     4345962
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class V
   4345962
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 4345962
NCBI-ProteinID: XP_015650532
UniProt: Q6ZFI6 Q6ZJZ3
LinkDB
Position
8:complement(24828142..24830915)
AA seq 402 aa
MADYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTT
GTPFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGY
GADLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLSAVRKILDKHRHPALLLVDGVSS
ICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYLK
FYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQ
KEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQL
MGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggactacgtgtatgggccggggcggaaccacctgttcgtgcctgggccggtgaac
atcccggaccaggtgatccgcgccatgagccgtcagaacgaggactaccgctcgccggcg
gtgcccgccctcaccaagaccctcctcgaggacgtcaagcagatcttcaagaccaccacc
ggcacccccttcctcttccccaccaccgggacgggggcgtgggagagcgcgctgacgaac
acgctgtcgccgggggacaagatcgtgtcgttcctgatcgggcagttcagcctgctgtgg
atcgaccagcagcaacgcctcaacttcaacgtggacgtggtggagagcgactggggctac
ggcgccgacctcgccgccctcgactacaagctccgccaggacccctcccactccatcaag
gccatctgcatcgtccacaacgagaccgccactggagtcaccaacgacctttccgccgtc
cgcaaaatcctcgacaagcacaggcacccggcgctactactggtggacggggtgtcatcg
atatgtgcgttggacttccgcatggatgagtggggagtggacgtggcgctgacgggttcg
cagaaggcgctctcgctgccgacgggtctgggcatcgtgtgcgcgagccccaaggcgctg
gaggcgagcaagacggccaagtcggtgcgggtcttcttcgactggaaggactacctcaag
ttctacaagatgggcacctactggccctacaccccatccatccagctcctctacggcctc
cgcaccgccctcgacctcatcttcgaggaaggcctcgagaacgtcatcaagaggcacaac
cgcctcggcaccgccaccaggctggccgtggaggcgtgggggctcaagaactgcacgcag
aaggaggagtggttcagcgacaccgtcaccgccgtcgtcgtgccgccgtacatcgacagc
gccgagatcgtgaagcacgcctggaagcggtacaacctcagcctcggcctcggcctcaac
aaggtcgccggcaaggtgttcaggatcggccacctcggccacctcaacgagctgcaattg
atgggtgccctgagtggagtggagatggtgctcaaggacatcggctacccggtgaagctc
ggctccggcgtggcggcggcggcggcgtacctgtcgaattcgacgccgctcatcccgtcc
aggatctga

DBGET integrated database retrieval system