KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345970
Entry
4345970           CDS       T01015                                 
Name
(RefSeq) pseudouridine-5'-phosphate glycosidase isoform X1
  KO
K16329  pseudouridylate synthase [EC:4.2.1.70]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4345970
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.70  pseudouridylate synthase
     4345970
SSDB
Motif
Pfam: Indigoidine_A TPP_enzyme_N
Other DBs
NCBI-GeneID: 4345970
NCBI-ProteinID: XP_015650930
UniProt: Q6ZK87 A0A0P0XHD2
LinkDB
Position
8:complement(24929573..24934805)
AA seq 361 aa
MSPSSSSSSTGPMGVAVSPEVEAALARGGAVVALESTIICHGMPYPKNLQTAMEVEAVVR
ENGAVPATIAILNGVPHVGLSGEQLKSLAVSGRQFQKTARRDIAHVVASGGNGATTVSAT
MFFAHKVGIPIFVTGGIGGVHRNGEQTMDISSDLTELGKTPVTVISAGVKSILDIPRTLE
YLETQGVTVAAYKTNEFPAFFTEVSGCKVPCRVDSPEECAKIIYANKNLHLGSGILIAVP
IPKEHAASGNAIESAIQKALKEAEYCPYSQPPALSLYLFCVFVILTEMISNDFLCCFRDK
NIIGNAITPFMLDRVKVLTGRSSLEANIALVKNNALVGAKIAVALSDLHQRVTNRFRRSA
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgccgtcgtcgtcgtcgtcgagcacggggccgatgggggtggcggtgtcgccggag
gtggaagcggcgctggcgcgcggcggcgcggtcgtcgccctcgagtccaccatcatctgc
cacggtatgccctacccgaagaatctccagaccgccatggaggtggaggccgtcgtgagg
gagaacggggcggttcctgccaccatagccattctgaacggcgtgccacatgttggcctt
agcggcgagcaattgaagagcttggctgtaagtggaagacagtttcagaagacggctaga
agggatattgcacatgttgtggcctctggtggtaatggtgcaacaacagtttctgccact
atgtttttcgctcataaggttggcataccaattttcgtaactggagggattggaggtgtt
catagaaatggtgaacagaccatggacatctcctcagacttaactgaacttggaaagact
cctgtcactgttatttcagctggtgtgaaatctattttggacataccacggacacttgag
tacttggaaactcaaggagtaacggttgctgcttacaaaaccaatgaatttcctgctttc
tttacagaagtcagcggatgtaaggtgccatgtcgcgttgattctcccgaagagtgtgcc
aagataatatatgcaaacaagaatttacatctaggatctgggattttgattgctgtgccg
attcccaaggaacatgcagcttcaggaaatgctatagagtctgcaatacagaaagccctc
aaggaagcagagtattgtccttactcccaacctcctgctctctcactttatcttttctgt
gtatttgtgatactaacagaaatgatatctaatgactttctatgttgtttcagggataaa
aatataataggcaacgcgatcactcccttcatgcttgacagagtgaaagtactaactgga
cgatcttcgctagaagccaatattgcgcttgtaaagaacaatgctcttgttggtgctaaa
attgctgtggccctttctgatcttcaccagagagtaacaaacagatttcggaggtctgcc
ttatag

DBGET integrated database retrieval system