KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346136
Entry
4346136           CDS       T01015                                 
Name
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4346136
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4346136
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     4346136
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4346136
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4346136
NCBI-ProteinID: XP_015650872
UniProt: Q6YZE2
LinkDB
Position
8:complement(26531393..26534074)
AA seq 478 aa
MAGAAAASAAAAAVASGISARPVAPRPSPSRARAPRSVVRAAISVEKGEKAYTVEKSEEI
FNAAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSRMWDVDGNEYIDYVGSWGPAIIGHA
DDTVNAALIETLKKGTSFGAPCVLENVLAEMVISAVPSIEMVRFVNSGTEACMGALRLVR
AFTGREKILKFEGCYHGHADSFLVKAGSGVATLGLPDSPGVPKGATSETLTAPYNDVEAV
KKLFEENKGQIAAVFLEPVVGNAGFIPPQPGFLNALRDLTKQDGALLVFDEVMTGFRLAY
GGAQEYFGITPDVSTLGKIIGGGLPVGAYGGRKDIMEMVAPAGPMYQAGTLSGNPLAMTA
GIHTLKRLMEPGTYDYLDKITGDLVRGVLDAGAKTGHEMCGGHIRGMFGFFFTAGPVHNF
GDAKKSDTAKFGRFYRGMLEEGVYLAPSQFEAGFTSLAHTSQDIEKTVEAAAKVLRRI
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccggagcagcagccgcctccgccgccgccgccgccgtggcgtccgggatctcggcc
cggccggtggccccgaggccctctccctcgcgcgcgcgcgccccacggtccgtcgtgcgg
gcggccatctccgtcgagaagggggagaaggcgtacacggtggagaagtccgaggagatc
ttcaacgccgccaaggagttgatgcctgggggtgttaattcaccagttcgtgccttcaaa
tcagttggtgggcagcccattgtgtttgattctgtgaagggttctcgtatgtgggatgtg
gatggaaatgaatatatcgattatgttggttcctggggtcctgcgatcatcggtcatgca
gatgatacggtgaatgcagcattgattgaaactctaaagaaaggaactagctttggcgct
ccatgtgtgttggagaatgtgttggctgagatggtcatctctgctgtaccaagtatcgaa
atggtccgttttgtcaattcagggacagaagcctgcatgggagcgctgcgccttgtgcgt
gcattcactgggagagagaagattctcaagtttgaaggttgttaccatggccatgcagat
tccttccttgttaaagctggcagtggtgttgccacccttggcctcccagactcccctgga
gtccccaagggagccacatctgagactctaacggcaccatacaatgatgtcgaggcagtg
aaaaaactgtttgaggagaacaaagggcagattgctgctgtcttccttgagcccgttgtt
ggcaatgctggcttcattcctccacagcccggttttctgaatgctctccgtgacttgacg
aaacaagacggtgcacttttggtctttgatgaagtgatgacgggtttccgtttagcttat
ggtggggctcaagaatacttcgggatcacccctgatgtgtcaacattggggaaaatcatc
ggtggcggtcttccagttggcgcttatggtggacgtaaggacatcatggagatggttgct
ccagcagggccaatgtaccaggcaggaaccctcagtggaaaccctctagctatgactgct
ggaatccacacactcaagcgtctgatggagcctggaacctacgattacttggacaagatc
actggtgatcttgttcgcggggtattggacgcgggtgcgaaaactggacatgagatgtgt
ggaggacacatcagggggatgttcgggttcttcttcaccgctggcccagttcacaacttt
ggtgacgcgaagaagagtgacaccgccaagtttgggaggttctaccggggcatgcttgaa
gaaggtgtgtacctagctccatcccagtttgaggcaggtttcaccagcttggcacacacc
tcccaggacatcgaaaaaaccgtggaggcagctgcgaaagttcttcgccggatatag

DBGET integrated database retrieval system