KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346316
Entry
4346316           CDS       T01015                                 
Name
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP18-2
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4346316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4346316
   03110 Chaperones and folding catalysts [BR:osa03110]
    4346316
Enzymes [BR:osa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     4346316
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4346316
 Complex C
    4346316
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    4346316
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 4346316
NCBI-ProteinID: XP_015649749
UniProt: A3BVR3 Q93VG0
LinkDB
Position
8:complement(27999798..28002384)
AA seq 164 aa
MWGSADGGTPEVTLETSMGAFTIEMYYKHAPKTCRNFLELSRRGYYDNVIFHRIIKDFIV
QGGDPTGTGRGGESIYGAKFEDEIRPELKHTGAGILSMANAGPNTNGSQFFITLAPCQSL
DGKHTIFGRVSKGMEIVKRLGSVQTDKSDRPIHEVKILRTVVKD
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtggggcagcgccgacggcggcacgccggaggtcaccctggagacatccatgggcgcc
ttcaccatcgagatgtactacaagcacgcgcccaagacctgcaggaacttcctcgagctc
tcgcgccgcggctactacgacaacgtcatcttccatcgcatcatcaaggatttcatcgtg
caaggtggggatcctactggcaccggaagaggcggcgaatccatctacggagcaaagttc
gaggatgagattaggccagaactgaagcacaccggcgctggaattctgtcgatggccaac
gctggtccaaatacaaatggaagccagttctttattactcttgcgccttgtcagtcactt
gatggaaagcatacaatttttgggagagtatcaaaaggaatggaaattgtcaagcgcctt
ggaagtgtccagacagacaaaagtgataggcccatccatgaagtgaaaatcctgcggact
gtggtcaaagattga

DBGET integrated database retrieval system