KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346318
Entry
4346318           CDS       T01015                                 
Name
(RefSeq) dihydroxy-acid dehydratase, chloroplastic
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4346318
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4346318
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     4346318
SSDB
Motif
Pfam: ILVD_EDD
Other DBs
NCBI-GeneID: 4346318
NCBI-ProteinID: XP_015649747
UniProt: A3BVR4 Q6YZH8
LinkDB
Position
8:28004843..28009254
AA seq 594 aa
MQSLALTSPSLPAPATASGRRRRRLERIRATAVSDEPKLNKYSARITEPKSQGASQAVLY
GVGLTDADLRKPQVGVSSVWYEGNTCNMHLLRLAEAVRDGVREAGMVAFRFNTVGVSDAI
SMGTRGMCYSLQSRDLIADSIETVMGAQHYDANISIPGCDKNMPGTIMAMGRLNRPSIMI
YGGTIKPGHFQGNSYDIVSAFQCYGEFVTGSISDEQRKNVLRNSCPGAGACGGMYTANTM
ASAIETMGMSLPYSSSTPAEDPLKLEECRLAGKYLLELLKMDLKPKDIITEKSLRNAMVI
VMALGGSTNAVLHLIAIARSVGLQLTLDDFQKVSDQVPFLADLKPSGKYVMEDLHKIGGT
PAVIHYLLEQGLLDGDCMTVTGKTLAENAKIFPPLSEGQQIIRPLDNPIKSTGHIQILYG
NLAPEGSVAKITGKEGMFFSGPALVFEGEESMITAISENPANFKGKVVVIRGEGPKGGPG
MPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQEGGPIGLVQNGDKIT
IDVVKRVIDVELTEAELEERRRKWTPPPHKAARGALWKYTKLVSPASRGCVTDE
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcagtcgcttgccctcacctccccctcccttccggcgccggcgaccgcatccggccgc
cgccgccgccgcctggagcgcatccgcgccaccgcggtgtccgacgagccgaagctgaac
aagtacagcgcgcgcatcacggagcccaagtcgcagggggcgtcgcaggcggtgctctac
ggcgtggggctcaccgacgccgacctccgcaagccgcaggtgggcgtctcctccgtctgg
tacgagggcaacacctgcaacatgcaccttctccgcctcgccgaggccgtcagggacggc
gtccgcgaggccggcatggtggccttccgcttcaacaccgtcggggtcagcgacgccatc
tccatgggcacccggggcatgtgctacagcctccagtcgcgcgacctcatcgccgacagc
atcgagaccgtcatgggcgcgcagcactacgacgccaacatctccattcctggatgcgac
aagaacatgccaggaacaataatggcaatggggcggctgaaccgaccaagtatcatgata
tatggtggaactattaagcctggtcattttcagggtaattcttatgacatagtatctgct
ttccagtgctatggagaatttgttaccggatcaatcagtgatgagcaaagaaagaatgtg
ctccgcaactcatgcccaggagcaggtgcgtgtggtggtatgtacaccgcaaatacaatg
gcatccgccatcgagaccatgggtatgagccttccgtacagttcttcaacccctgctgaa
gacccactaaagctagaggaatgccgtcttgctgggaagtatcttttagaattgttaaag
atggatttgaagcctaaagacattatcactgagaaatctttgcggaacgcaatggtcatt
gtcatggcacttggtgggtctactaatgctgttttgcatttaattgctatcgctaggtct
gtaggtctgcaattaactcttgatgattttcagaaggtcagtgaccaagttcctttcctt
gcggaccttaagcctagtggcaaatatgtcatggaggatctgcataagattggtggaaca
cctgcagtaattcattatcttctggagcaaggtcttcttgatggtgattgtatgaccgtc
actgggaaaactctagcggaaaatgctaaaatcttccctcctctgtccgaaggacagcaa
ataataaggcccctggacaacccaatcaaatcaactggtcatatacaaatactttatggc
aatcttgcaccagaaggttctgtagcaaaaattactggcaaagaggggatgtttttctca
ggccctgcactagtgtttgagggtgaagaatctatgattacagctatatcagaaaaccca
gcgaatttcaaggggaaggtagtagtgatacgaggagaaggaccgaaaggtggaccaggg
atgcctgaaatgctgactccaactagtgcaataatgggtgctggtcttgggaaggagtgt
gccctgctgaccgatggcagattttctggaggatcacatggatttgttgtaggccacatt
tgtcctgaagcacaggagggaggtccaattggtcttgttcaaaacggtgacaaaattacc
attgatgttgtgaagagagtaattgatgttgaactgactgaagctgagctggaagaaaga
cggaggaaatggacgccgccgccacacaaggctgcccgtggagcgctttggaagtacacg
aagctcgtgtcccctgcatcaagaggatgcgtcaccgatgagtag

DBGET integrated database retrieval system