KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346332
Entry
4346332           CDS       T01015                                 
Name
(RefSeq) malate dehydrogenase [NADP], chloroplastic
  KO
K00051  malate dehydrogenase (NADP+) [EC:1.1.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4346332
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4346332
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.82  malate dehydrogenase (NADP+)
     4346332
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N SH3_14
Other DBs
NCBI-GeneID: 4346332
NCBI-ProteinID: XP_015649513
UniProt: Q6YYW3 B9FYK4
LinkDB
Position
8:28141047..28144906
AA seq 433 aa
MAAIDLSSPARSSPAPLSPRRGSLHLLLRRPRRPTLRCSLDAAPKQAQAQGPPAAVAAEE
APTARKECYGVFCTTYDLRADEKTKSWKSLVNVAVSGAAGMISNHLLFKLASGEVFGPDQ
PIALKLLGSERSIQALEGVAMELEDSLYPLLREVSIGIDPYVVFEDAEWALLIGAKPRGP
GMERSALLDINGQIFAEQGKALNSVASRNVKVIVVGNPCNTNALICLKNAPNIPAKNFHA
LTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNAKINGRPVKEVIKDTKW
LEDEFTKTVQKRGGVLIQKWGRSSAASTAVSIVDAIRSLVNPTPEGDWFSTGVYTTGNPY
GIAEDIVFSMPCRSKGDGDYELVKDVAMDDFLWERIKKSEAELLAEKRCVAHLTGEGNAF
CDLPGDTMLPGEM
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcggcaatcgatctctcctcccccgcaagatcatcgccggcgcctctctccccgcgc
cgcggctccctgcacctcctcctccgacgcccgcgccgacccaccctccgctgctccctc
gacgccgcgccaaagcaggctcaggctcagggcccgcccgcggcggtcgcggcggaggag
gcgcccaccgcgcgcaaggagtgctatggcgtcttctgcaccacctacgacctcagggcg
gatgagaagacaaagtcctggaagagcttagtgaatgttgctgtgtcgggtgcagcaggg
atgatatcaaatcatctgcttttcaaacttgcctctggtgaggtttttggaccggaccaa
ccaatagcacttaagttgttgggctctgaaagatcaatacaagcacttgaaggtgtggct
atggaattggaggattcactgtatccattgctaagggaagtcagcattggtatagaccct
tatgtagtcttcgaagatgcagaatgggctcttcttattggggctaagcccagaggtcct
ggaatggagcgatctgccttactagatatcaacggtcaaatctttgctgaacaggggaaa
gcacttaactccgtggcatctcggaatgtgaaggtcatagttgtcgggaacccctgtaac
actaatgcattgatttgcttaaagaatgctcccaacataccagcaaaaaactttcatgca
ttgacgaggttggatgaaaatagagccaagtgccagctggcactaaaagcgggtgtattt
tatgacaaagtatcaaatatgactatttgggggaaccactcaacaactcaggttcctgat
tttttgaatgctaaaattaacgggagaccagtgaaagaagtcattaaagacacaaagtgg
ttagaagatgaattcaccaaaacagttcaaaagcgtggaggagtactcatacaaaaatgg
ggcagatcttcagctgcatcaaccgccgtttccatcgtggatgctattaggtcccttgta
aatcctaccccagaaggcgattggttctctactggggtttatacgactggaaatccttat
ggcatagcagaggacatcgtgttcagtatgccatgcaggtcaaagggtgatggtgactac
gaactagttaaagatgtggcaatggacgatttcctctgggaacggataaaaaagagtgaa
gctgaattgctcgccgagaaaagatgcgttgcccatcttactggagagggcaatgcattt
tgtgatcttcccggagacaccatgcttccaggagaaatgtag

DBGET integrated database retrieval system