KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346365
Entry
4346365           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4346365
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4346365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4346365
   03400 DNA repair and recombination proteins [BR:osa03400]
    4346365
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     4346365
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    4346365
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4346365
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 4346365
NCBI-ProteinID: XP_015651249
UniProt: B9G222
LinkDB
Position
9:complement(244490..248922)
AA seq 452 aa
MAAAEEAILQKRKKQAEEMLAPLPFPHLTAAEETPPNPETPISGEAVAVAVRRKERKRKN
EEAAGVGKEKKRKSREGPPAPEARRKERKRMLMPRQPSHDQIHGIQVQANPPPLAGGRDE
AYGRSSCKKIRVLSNREIIKMRIQLRKHQPLPQGIFDPEIIMASNSTQQDPNHSSPFGAF
FDQFCYKPTRQDRTPPLPRTPDLLVRPPPRDHLSSASSQLMTNHTCKINSTCKTTTFKTR
SGPNQGNTKVKEMARVNKERKPAPLLSRAEKRSDKYRRLPLDQLVPPPRSPHKLLQEKYA
SDPWKVIVICMLLNLTQGKQVRRKVKGFFKRYPDAQTAFSADPEKMAKYLAPLGLQRVKV
NRIQRFSKAYVEEEWTYITELCGVGKYAADAYAIFCAGRATEVVPADHKLVDYWKYVCFE
LPMIQQSQDMQEAGVTEMEHAVPKVEELAVCC
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcggcggcagaggaggcgattctgcagaagcggaagaagcaggcggaggagatgttg
gccccgttaccttttccccacctgacggcggctgaagagaccccgcccaaccccgaaacc
ccaatctcgggagaggcggtggcggtggcggtgaggagaaaggagcggaagaggaagaat
gaggaggccgcgggcgtggggaaggagaaaaagcgaaagagtagggaggggccaccggcc
ccggaggcgaggaggaaggagcggaagcggatgctgatgcccagacaaccatctcatgac
caaatccacggcatccaggtacaagcaaaccctcctccactggccggaggacgagatgaa
gcgtatggcaggagtagctgcaagaagatccgcgtcctgagcaaccgcgagatcatcaag
atgaggatacaattgaggaagcaccagccactacctcaaggcatttttgacccagagatt
attatggcttccaattccacccagcaggaccccaatcattcttcgccattcggcgccttc
tttgaccagttctgctacaaacccacccgccaagatcgcactcccccacttcctagaacg
cctgaccttctagtcaggccgccgcctcgggatcatctatcatctgcttcatctcagctc
atgacaaatcacacctgcaagatcaacagcacctgtaagacaacaaccttcaagacaaga
tcaggaccaaaccaaggaaatacgaaggtaaaagaaatggcaagggtgaacaaggaacga
aaaccagcaccgctgcttagccgtgctgaaaagaggtcagacaaataccgccgccttccg
ttggaccagctggtgcctccgccacgctcccctcataagctactgcaggaaaaatacgct
tctgacccgtggaaggtcattgtcatctgcatgctcctcaacttaacacaggggaaacaa
gtgaggaggaaagttaaggggttcttcaaacgatatcctgatgctcaaactgcatttagt
gctgatcctgaaaagatggccaagtatctggctcctctgggtttgcagcgtgtaaaagta
aacagaatccagagattctctaaggcgtatgttgaagaagaatggacctacattactgag
ctttgtggtgttggcaagtacgcagctgatgcttatgcaatcttctgtgcgggcagggca
acagaggtggtacctgcagaccataagttagttgattactggaaatatgtttgtttcgag
ttgcccatgattcagcaatctcaggacatgcaggaagctggagtgactgagatggagcat
gctgtccccaaggtggaggaattggccgtgtgctgctaa

DBGET integrated database retrieval system