KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346392
Entry
4346392           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 3
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4346392
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4346392
   03400 DNA repair and recombination proteins [BR:osa03400]
    4346392
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     4346392
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4346392
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 4346392
NCBI-ProteinID: XP_015612385
UniProt: B9G242 Q6YX88
LinkDB
Position
9:927068..933801
AA seq 330 aa
MERAAGGVSYQRFPRVRIRELKDDYAKFELRDTDASMANALRRVMIAEVPTVAIDLVEIE
VNSSVLNDEFIAHRLGLIPLTSAAAMAMRFSRDCDACDGDGSCEYCSVEFHLAARATDSD
QTLEVTSNDLRSTDPKVCPVDQARAYQHALGGTEPFDTAAAADQRGILIVKLRRGQELRL
RAIARKGIGKDHAKWSPAATVTFMYEPEIRINEELMETLTLEEKRNLVESSPTKVFNIDP
NTQQVVVEDAEAYTYDDEVIKKADAMGKPGLIEINAKEDSFIFTVETTGAITAYELIMNA
ITVLRQKLDAVRLQDDDADLGELGAHLVGG
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagcgggcggcaggcggcgtgtcgtaccagcggttcccgcgggtgcggatccgcgag
ctgaaggacgactacgccaagttcgagctccgcgacaccgacgccagcatggccaacgcc
ctccgccgcgtcatgatcgccgaggtccccaccgtcgccatcgacctcgtcgagatcgag
gtcaactcctccgtcctcaacgacgagttcatcgcccaccgcctcggcctcatccccctc
acctccgccgccgccatggccatgcgcttctcccgcgactgcgacgcctgcgacggcgac
ggctcctgcgagtactgctccgtcgagttccacctcgccgcccgcgccaccgactccgac
cagaccctcgaggtcacctccaacgacctccgctccaccgaccccaaggtctgccccgtc
gaccaggctagggcctaccagcacgccctcggcggaactgaacccttcgacaccgccgct
gctgctgaccagaggggcatactaattgtaaagctgcgtcggggccaagagctcaggctc
cgagcaattgctaggaagggaattggcaaggaccatgccaagtggtcccccgccgctact
gtgactttcatgtatgagcctgaaatacgtatcaatgaagaactcatggaaacattgaca
ctcgaggaaaaacgaaatttggtggagagtagccctacaaaagtgttcaacattgatccc
aacactcaacaggtggtagttgaggatgcagaggcatatacatatgatgatgaggtcatc
aagaaagcagatgccatgggaaagcccggattgatagagatcaatgccaaggaggacagc
tttatcttcactgttgaaacaactggcgctatcacagcttatgagctgatcatgaacgct
atcacggtcttgaggcaaaagttagatgctgttcgtctacaagatgacgatgctgacctt
ggcgagcttggtgcccaccttgttggaggctaa

DBGET integrated database retrieval system