KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346428
Entry
4346428           CDS       T01015                                 
Name
(RefSeq) CCR4-NOT transcription complex subunit 10
  KO
K12607  CCR4-NOT transcription complex subunit 10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346428
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346428
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4346428
SSDB
Motif
Pfam: SRP_TPR_like TPR_12 Coatomer_E RCDG1 RinB
Other DBs
NCBI-GeneID: 4346428
NCBI-ProteinID: XP_015612280
UniProt: A0A0P0XJW7 Q6K272
LinkDB
Position
9:1780083..1786087
AA seq 827 aa
MEPKEAPPPPPPQSPSSTEEEGMLSVTAAMARDAAVLFQSRRYADCAEVLAQLLLKKEGD
PKVLHNMAIAESFLDGCPDPKKLLEILGNVKRRSEELACASRQQTDSANGTGNSVSSGSR
GSGIIPLISAANNATTYGDEFDTTIITFNTAVILYHLHDYESALSILDPLYRNIEPIDET
TALHVCFLLLDITLALQDASNAADIIQYLERSFGVVSATNQNENANTAQQQSAQPKPSAK
ISTPPDSDSNTCAGGSENLSAGNFSDDTLEFESFYSTLDGGNQNLGRPILNDFSRASADL
AATAADLKVRLQIYKVRLLLLTRNLKVAKRELKVLMNMARGRDSSTELLLKSQLEYARGN
YRKAVKLLSTPNNRSEQAMLAMFYNNLGCILHQQRSIQTSVWCFSKALKYSLSLRSEKPC
KLTAISQDKSCLISYNCGIQHLMCGKPLLAARCFREAMPLLCNRSLFWLRFAECSLLALE
KGILTSSGATSCNDEIEVDVMGSGKWRHLVINPVKPSHSSESGEEVSLDKYGNLISLRFA
RQCLLNAQILLDPSTKENLVIASGTEESNQTSLQGQKGSGQKNTTNTDSKPPGPALTNAN
GEQKGISNLNVTLQSSLALYDDICRKENLKIKQAILGDLAFIELCLQNHLKALSIAKLLQ
QLPECSRMYVFLSHVYAAEALCALNRPKEAAEQLTVYLRDGDDIELPYSIENCEKALVEK
DSDGEDSVAPVVTKLSSGESQYSESLKPEEAQGVLYIDLGMTAAVQGELEQANYMVSRGV
ALLPNNPRAVLASVYVDLLQGKAQEAIAKLRRCRTVRFRRHSVAVSS
NT seq 2484 nt   +upstreamnt  +downstreamnt
atggagcccaaggaggcgcccccgccgccgccgccccagtctccgtcctccaccgaggag
gaagggatgctctccgtcacggccgctatggccagagacgccgccgtgctgttccagagc
cgccgctacgccgactgcgccgaggtgctcgcgcagctcctgctcaagaaggagggcgac
cccaaggtccttcacaatatggctattgcagaatctttcttggatggttgtcctgaccca
aagaaattgcttgaaattctaggcaatgttaagagaagaagtgaagagcttgcctgtgca
tctagacaacaaactgattctgccaatgggacaggaaacagtgtttcttctggatcaaga
gggagtggcattatacctctgatttctgctgcaaataatgcgacaacctatggggatgag
tttgacacaaccataataacattcaacactgctgttatcctttaccatcttcacgattat
gaatctgcactatctattttggatccactctaccgaaatattgaaccaattgatgagaca
actgctcttcatgtatgctttctgttgttggatattacattagctttgcaagatgcatcg
aatgccgcggatataattcagtacttggaaaggtcatttggagtagttagcgcaacaaac
cagaatgaaaatgctaatacagctcagcagcagtcagctcaaccaaagccttctgcaaag
attagcacacctccagattctgattcaaatacttgtgctggtggatctgaaaacctttca
gcaggaaatttttctgatgatacacttgagtttgaatctttttactctaccttggatggt
ggtaatcagaacttgggcagaccaattttaaatgatttctcaagggcttcagctgatctt
gctgccactgctgctgatttgaaagttagactgcaaatatacaaggtccggcttctgctt
cttactaggaaccttaaggttgcaaagcgagaactgaaagttctgatgaacatggcacgt
ggtagggattcatcaacagagcttctcctgaaatctcagttggaatatgccagaggaaac
tatcgcaaggctgtgaagctgctgagcacacccaataatcggagtgaacaagcaatgctg
gccatgttctacaataatcttggttgcatactccaccaacagagatctattcaaacctca
gtatggtgcttcagcaaagcattgaaatatagcttatcacttcgttcagagaaaccatgc
aagctgaccgcaatatcgcaagacaaatcttgtcttatttcatacaactgcggcatccaa
catttgatgtgcgggaaacctttgttagcagctcgctgttttcgtgaagccatgccgctc
ttgtgcaacaggtccctcttttggctccgttttgctgagtgtagcctgctagctctggaa
aagggtatcctgacttcaagtggtgctacttcgtgcaatgatgagattgaagttgatgtt
atggggtcaggaaaatggcggcacttagttataaacccagtgaagccaagtcattcttca
gaatctggggaggaggtaagtttggacaaatatggaaatctgatatcccttagatttgct
agacagtgtctactcaatgcccaaattttattggatccctctacgaaggaaaatctggtg
attgcatcaggcacagaggaatcgaatcaaacatcactgcaaggccagaaaggctcaggt
cagaagaacaccactaatacagattccaaaccgcctggtccagcactaactaatgcaaat
ggagaacagaagggaatttcaaacttgaatgtcaccttgcagagctctcttgctttgtat
gatgacatatgtagaaaagagaacctcaaaattaaacaagccatcttgggggaccttgca
tttattgagttgtgtcttcagaatcacttgaaagctttgtctattgccaagttgctacag
cagctgccagaatgttccaggatgtatgttttcctcagccatgtatacgcagctgaagca
ctttgtgcactgaatagaccaaaggaggctgctgagcaattaactgtttatttgagagat
ggcgatgatattgagttgccttacagcattgagaactgcgagaaagcccttgttgagaaa
gacagcgatggtgaagattcagttgctccggtagtcacaaaattgtcctcaggagaatct
cagtattcagaaagcctcaagcctgaggaagctcagggtgttctttatattgacctaggc
atgacagctgcagtgcagggagagcttgagcaggctaactatatggtaagccgtggcgtt
gccttgttgcccaacaaccccagggcagtgctagcatcagtttatgtggaccttcttcaa
gggaaggcacaagaagcaatcgccaagttgagacgatgtagaactgtgagatttaggagg
catagtgtagcagtcagcagttaa

DBGET integrated database retrieval system