KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346506
Entry
4346506           CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein Prp3 isoform X1
  KO
K12843  U4/U6 small nuclear ribonucleoprotein PRP3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4346506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4346506
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4346506
SSDB
Motif
Pfam: PRP3 DUF1115
Other DBs
NCBI-GeneID: 4346506
NCBI-ProteinID: XP_015612127
LinkDB
Position
9:complement(3750997..3754996)
AA seq 614 aa
MEIPGVVWCPMLVLSNRSMLHLLWCHHLFLCLQSTDGSTSSAAGKSSNLSLDALAKAKKA
LQLKKELSEKLKKLPVLNNKLGVTSTDTQIPKKETQPVSSSGASEMAVGAALTEKMAATA
GAVGIPGLANIPNLDAVKRAQELAAKMGFRQDPQFAPLINLFPGTSSELTVPQKPAKAPV
LRLDAQGREIDEHGNVINMTKPTNLSTLKVNINKQKKEAFQIIKPDLDSLAKSSAHFDER
MGINQNKLLRPRRPGFQFIEEGKLSRQAELQRIKNQFGEAQAKELKVKQAQLAKAKAEVV
MNPNLIEVAPGRPPKQKQKEEIPEIEPWDAKILPSTTYDDFSMEKVNMEKITIYVEHPEP
LEPPAEPAPPPPQPLKLTKKEQKKLRTQRRLAKEKDRQEMIRQGLLEPPKPKVKMSNLMK
VLGAEATQDPTRMELEIRTAAAEREQAHVDRNIARKLTPSERREKKERKLFEDPNTLETI
VCVYRIRDLSHPQTRFKVDVNAQENRLTGAAVIADGISVVVVEGGKKSIKRYNKLMLNRI
DWAAAVDDDDDADEESDKPVNSCALVWQGSVAKPCFTRFSVHNCRSEAAAKKVFADASVP
HYWDLAVNFSEDSS
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggagattcccggagtggtctggtgcccaatgctggtgctcagcaaccgctcaatgctg
cacctgttgtggtgccatcatctgttcctatgccttcaaagtacagatggaagtacaagt
tcagccgctggcaaaagtagtaatctatctcttgatgctttagccaaagctaaaaaagca
ttgcaactgaagaaggaactatcagaaaaactcaagaagctacctgtgcttaataataaa
cttggtgttactagtactgatacacaaattcctaagaaagaaacacagcctgtttctagc
tctggtgcatctgaaatggctgtgggtgcagctcttactgagaagatggcagctacagca
ggtgcagttggtattccaggccttgctaacattcccaatttggatgctgtgaagcgagca
caggaacttgctgctaagatgggattcagacaggatccacaatttgcgcctctcatcaat
ttgtttcctggtacatcctctgaactaactgtgcctcaaaaacctgcgaaggcacctgtt
ctccgtcttgatgctcagggtagggaaattgatgaacatgggaatgttatcaacatgacc
aagccaaccaatttgagcactctaaaagttaacataaataagcaaaagaaggaagctttc
caaataatcaaaccagacttggattcccttgcaaaatcaagtgcacactttgatgaaagg
atgggcatcaaccaaaacaagctcctccgccctagaaggcctggatttcagtttattgag
gagggaaaactttcaaggcaagctgagctgcagagaattaagaatcaatttggtgaagca
caagctaaagaacttaaagtaaaacaagctcaacttgcaaaggcaaaggcagaagtagtc
atgaacccgaacttgattgaagttgctcctgggaggcctccaaagcaaaagcagaaggaa
gagattcctgaaattgagccatgggatgcaaaaattttaccttctacaacatacgacgat
ttctccatggagaaggttaatatggaaaaaatcactatatatgtagagcatccagagcca
ctggagccaccagctgagcctgcaccaccaccgcctcagccacttaagctgactaagaag
gagcagaagaaactcagaacacaaaggcgccttgctaaagagaaagacaggcaagaaatg
atcaggcaaggcctcttggagccaccaaagcccaaggtcaagatgagcaatcttatgaaa
gtactaggagctgaagctacacaggatccaacacgtatggagttggaaatacggactgct
gctgcagagcgtgagcaggctcatgtagatcgcaacattgctcgcaagctcactccatca
gagcgccgtgaaaagaaagagaggaagctttttgaagatcctaacacattggagactata
gtttgtgtgtacagaatcagagacctgtcacatccgcagacacgttttaaggtggatgta
aatgcacaagagaaccgtcttactggtgctgcagtcattgcggatgggatcagtgttgtt
gtcgttgaaggagggaagaagtcaatcaaaaggtacaataagctgatgctgaaccgtatt
gactgggctgctgcggttgatgatgatgatgatgctgatgaggaatcagacaagcctgtg
aatagctgtgcattggtctggcaggggagtgtggcaaaaccctgctttaccaggttcagt
gtacacaattgccgtagtgaggctgctgccaagaaggtgtttgcagatgcttcagttcca
cactactgggacctggctgtcaatttctcagaagattcatcttga

DBGET integrated database retrieval system