KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346519
Entry
4346519           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP41 homolog
  KO
K11600  exosome complex component RRP41
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4346519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346519
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4346519
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     4346519
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4346519
NCBI-ProteinID: XP_015610638
UniProt: B9G2C8 A0A8J8XIX4
LinkDB
Position
9:3959833..3965031
AA seq 242 aa
MEYVNPLTGFRVDGRRPNEMRQLKGEVGVVARADGSALFEMGNTRVIAAVYGPREVQNKG
QQVNSKDALVRCEYRMADFSTGDRRRKPKGDRRSTEISLVIRQTMEASILTHLMPRSQID
IFVQVLQADGGTRAACINAATLALADAGIPMRDIVTSCSAGYLCSTPLLDLNYIEDSAGG
PDVTVGFLTKMDKVTLLQMDAKLPMDTFETVMDLAIEGCKAIANYIREVLLENTRRLECQ
RG
NT seq 729 nt   +upstreamnt  +downstreamnt
atggagtacgtgaaccctctcaccggcttccgcgtcgacggccggcgccccaacgagatg
cggcagctcaagggcgaggtgggcgtcgtcgccagggcagacggatcggcgctgttcgag
atgggcaacaccagggtcattgccgctgtctacggccctcgagaggtccagaacaaaggt
cagcaagtcaacagcaaagatgctttggtgcgttgtgagtataggatggcagattttagt
actggggatcgaaggagaaagccaaagggtgacaggcgatcaacagaaatttcacttgtt
atccggcaaacaatggaggcaagcattttaacacatttaatgccacgttcacagattgat
atatttgtccaagttcttcaagctgatggtggtacaagggctgcatgcatcaatgctgct
acattagcacttgcagatgctgggattcccatgcgagacattgttacatcttgcagtgct
ggttatctgtgttctactcctttgcttgatctgaattatatagaagacagtgctggaggt
ccagatgtcactgttggctttcttacaaagatggacaaagttactcttctgcagatggat
gcaaaattaccaatggatacatttgaaactgtaatggaccttgcaattgaaggctgcaaa
gctatcgcaaactacatccgagaggtgctattggagaacacaagacggctggagtgccag
cgtggttag

DBGET integrated database retrieval system