Oryza sativa japonica (Japanese rice): 4346592 Help Entry 4346592           CDS       T01015                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism osa  Oryza sativa japonica (Japanese rice) Pathway osa03083   Polycomb repressive complex osa04120   Ubiquitin mediated proteolysis osa04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:osa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     4346592    04120 Ubiquitin mediated proteolysis     4346592   09126 Chromosome    03083 Polycomb repressive complex     4346592  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:osa04131]     4346592    04121 Ubiquitin system [BR:osa04121]     4346592    03036 Chromosome and associated proteins [BR:osa03036]     4346592 Membrane trafficking [BR:osa04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     4346592 Ubiquitin system [BR:osa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      4346592    Cul7 complex      4346592 Chromosome and associated proteins [BR:osa03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      4346592   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      4346592 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  4346592 NCBI-ProteinID:  XP_015611420 UniProt:  Q6H4D0 A3BWS4 LinkDB All DBs Position 9:9938806..9939288 Genome browser AA seq 160 aa AA seqDB search MAAADGTTGEEVKKTIDLVSKDGERFEVARDAALLCKTLRWMIKGGYGRIPLPNVASPIL ARVVDYLARHAAAAAAMDDDGLDRFDRDFLAGVDQDTLFDLLLAANYLQADGLLDLACKK VAAMMTGKSPEQMREIFHIVNDLTPEEEKEIREDIAWALN NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggatggcaccaccggagaggaggtgaagaagacgatcgatctcgtcagc aaggacggcgagcggttcgaggtggcgagggacgcggcgctgctgtgcaagacgcttcgg tggatgatcaagggcggctacggccggatcccgctccccaacgtcgcctccccgatcctc gccagggtcgtcgactacctcgcccggcatgccgccgccgccgccgccatggacgacgac ggcctcgacaggttcgaccgcgacttcctcgccggcgtcgaccaggacacgctgttcgac ctcctcctcgccgccaactacctccaggccgacggcctcctcgacctcgcctgcaagaag gtcgccgccatgatgaccggcaagtcgccggagcagatgcgggagatcttccacatcgtc aacgatctcacgccggaggaggagaaggagatccgggaggacatcgcttgggcgctcaac tag

DBGET integrated database retrieval system