KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346649
Entry
4346649           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein of LHCII type 1
  KO
K14172  light-harvesting complex II chlorophyll a/b binding protein 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4346649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4346649
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4346649
SSDB
Motif
Pfam: Chloroa_b-bind DUF2735
Other DBs
NCBI-GeneID: 4346649
NCBI-ProteinID: XP_015651144
UniProt: A0A0P0XKP6 Q69TB3
LinkDB
Position
9:7185163..7188147
AA seq 321 aa
MPPPLLLRLRSPAPPAAVAAGSLSRRRRRRRAGLAPVRASWQELAGVLVFSAVPFTAVKA
LANSPLGARLRRRLDDRKAAAAAEADALRSAARQARTASSWYGDERPRWLGPVPYEYPAH
LTGEYPGDYGFDIAGLGRDPVAFANYFNFEILHCRWAMLAALGVVVPELLDLFGVVHFVE
PVWWKVGYAKLQGDTLDYLGIPGFRIAGGQGVIVIAICQALLMVGPEYARYCGIEALEPL
GLYLPGDINYPGGALFDPLGLSKDPVAFEDLKVKEIKNGRLAMVAWLGFYIQAAVTGKGP
IQNLVEHLSDPLHNNILSSFV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcctccaccactcctcctgcgcctccgctcacccgcgccacccgccgccgtcgccgcc
gggtccctctcccggcggcggcggcggcgcagggccggcctcgcgccggtgcgagcgtcg
tggcaggagcttgcgggggtgctggtgttctccgccgtgcccttcacggccgtcaaggcc
ctcgccaacagccccctcggcgcccgcctccgccgccgcctcgacgaccggaaggccgcc
gccgccgccgaggccgacgccctccgctccgccgcgcgccaagcccgcaccgccagctcg
tggtatggggatgaacggccgcggtggctaggccccgtgccgtacgagtacccggcgcat
ctcaccggagagtaccctggcgattacgggttcgatattgcaggcctgggcagggatccc
gttgctttcgcaaactacttcaactttgagatcttgcattgtcggtgggccatgcttgct
gctcttggtgttgttgttcctgaactgttagatctttttggagtagtccattttgtcgag
cctgtttggtggaaagttggttacgcaaaacttcagggtgacactcttgattaccttgga
attcctggtttccgaatcgctggtggtcagggtgtcattgtcatcgctatctgtcaagcc
cttttgatggttggtccagaatatgcaaggtactgcgggattgaggctctagaacccttg
ggattatatcttccgggagacataaactacccgggaggagcactcttcgatcccttgggg
ctctccaaagatccagtcgcgttcgaagatctaaaggtgaaggagatcaagaacggtcgc
ctggcaatggttgcatggctcggcttctacatccaggcagctgtaactggcaagggtcct
attcagaaccttgttgaacacttgtcggacccgctgcataacaacattttgtcctctttt
gtttga

DBGET integrated database retrieval system