KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346962
Entry
4346962           CDS       T01015                                 
Name
(RefSeq) protein EDS1L
  KO
K18875  enhanced disease susceptibility 1 protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4346962
SSDB
Motif
Pfam: EDS1_EP Lipase_3 Abhydrolase_3 Mbeg1-like Abhydrolase_6
Other DBs
NCBI-GeneID: 4346962
NCBI-ProteinID: XP_015612653
UniProt: Q6H415 A3BYH7
LinkDB
Position
9:13559553..13563070
AA seq 621 aa
MPAAAALSDDDRLVVAHCAALSFPPASQPPPPPTTSSSSSGAGAGASFQVHHASHPYPCA
AFAFPPSWSAAPGWAAAGRAAFGDAEVDPSLFPSLRSVGSGVPARANAAFLASFGALLDG
SPLQSEVSRAVAEEKRIVFTGHSSGGSIATLAAIWFLETCTRRGSVNQAHPFCVTFGAPL
VGDNTFNNAVRREGWSQCILNFVVPVDIIPRIPLTPLASATEGIQAVLDWLSPQTPNFSP
SGMPLIISQFYENLLRSTLSIASYEACSFMGCTSSILGTLTSFIELSPYRPCGTYLFLTS
SEQLAVLTNSDAVLQLLFYCLQLDPQQQLRDAAERSLSAHWQYEPIKQSMMQEIVCVDYL
GVVSSTLPGRQMSSTIVGGLELSKEAMLSLSAAGQWEKQRETNQAKIDGASCTKIREALK
SLNEYKRTCELHEVSYYDSFKLQREVHDFNANVSRLELAGLWDEIVEMLRRRELPDGFES
RQDWVNLGTLYRRLVEPLDIANYYRHSKNEDTGSYLSKGRPRRYKYTQEWHEQSQRISFG
SSLESCFWAMAEELQAEIANGKTFEDVRDRVVKLESDAHGWSMSGSLGKDIFLSRSSFVI
WWKTLPENHRSASCIAKLVPW
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgccggcggcggcggcgctgtccgacgacgaccgcctggtcgtcgcccactgcgccgcg
ctctccttcccacccgcctcccagccgccgccccctcccaccacctcctcctcctcctcg
ggcgccggcgcgggcgcctccttccaggtgcaccacgcgtcccacccgtacccctgcgcc
gccttcgcgttcccgccctcctggtccgccgcgcccggctgggccgccgcggggcgcgcg
gcgttcggggacgcggaggtggacccgtccctcttcccgtcgctccgcagcgtcgggagc
ggcgtccccgcgcgcgccaacgccgcgttcctcgcctccttcggcgccctcctcgacggc
tcgccgctccagtccgaggtatctagagctgtggcagaagagaagcgtattgtattcaca
ggccattcatcagggggttcaatagctacccttgctgccatatggtttcttgagacctgc
accaggagaggcagtgttaatcaggcacacccattttgtgtaacctttggggctcctctt
gttggagacaatacctttaacaatgctgttcgaagggagggctggtcacagtgtattttg
aattttgtcgtgccagtagacatcatcccccgcataccacttactccgcttgcatctgcc
acagaaggaattcaagctgttctggattggttatcccctcaaactccgaacttctcgcct
tctgggatgccactcatcataagtcagttttatgaaaatttactgagaagcacactttct
attgcgagctatgaggcctgttccttcatgggatgcactagctcgatcttaggaacattg
acttccttcattgagctctccccttacagaccctgtgggacttatcttttcttgacaagc
agtgaacagctggccgttctgacaaattcagatgctgtattgcagttgctattttactgc
cttcagttggatccccagcaacaattgcgtgatgctgctgagagaagtttaagtgctcat
tggcaatatgaaccaattaagcaaagcatgatgcaagagatagtttgcgtggattacttg
ggagtggtttcatcaacacttcctggtaggcagatgagtagcacaatagttggaggcctt
gaactgagcaaggaagctatgttgagcctttctgcagctggacaatgggagaagcaaagg
gagacaaaccaggcaaaaatagatggtgcaagctgcaccaaaattagggaagccctcaag
tctctgaacgagtacaaaaggacatgtgaactccatgaagtgagctactatgattccttc
aagcttcagcgtgaagtacatgactttaatgcaaatgttagcaggttggaactagctgga
ctctgggatgagatagttgaaatgctgcgaaggcgtgagctgccagatggtttcgaaagc
cgacaagattgggtgaatctaggaaccttgtaccgccggttggttgagcccttagacatt
gcaaactactataggcattccaagaacgaggacactggctcctacctctccaagggaagg
ccaagacgttacaagtacacccaggagtggcacgagcagtcgcagcgcatctccttcggt
tctagccttgagtcttgcttctgggcaatggctgaggaactccaggctgagattgctaac
ggcaaaacattcgaggatgtgagagatagagtagttaagcttgagagtgatgctcacgga
tggtccatgtctggaagtttagggaaggatatattcctgagccgttcttcttttgtgatt
tggtggaagacgctcccggagaaccacagatctgcatcatgcatcgcgaaacttgtgccc
tggtaa

DBGET integrated database retrieval system