KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347019
Entry
4347019           CDS       T01015                                 
Name
(RefSeq) U4/U6.U5 tri-snRNP-associated protein 2
  KO
K12847  U4/U6.U5 tri-snRNP-associated protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4347019
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4347019
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    4347019
SSDB
Motif
Pfam: UCH zf-UBP
Other DBs
NCBI-GeneID: 4347019
NCBI-ProteinID: XP_015611814
UniProt: Q69MX3 A0A0P0XLM2
LinkDB
Position
9:complement(14394553..14399420)
AA seq 554 aa
MAADDLSSPARKRGRDEEEEEEEEVIDGEAAQKRARGEDPEGGALLGLANYEEDEEDEEA
AAAAGRRRANGRHEEEEEEDDDDDEVDNDVRRAPERRPRQVELRRDCPYLDTVNRQVLDF
DFEKFCSISLSNLNVYACLVCGKYYQGRGLKSHAYTHSLEAGHHVFINLQTEKAYCLPDG
YEINDPSLEDIRHVLNPRFTTEQVRNLDRNKQWSRALDGSNYLPGMVGLNNIKETDFVNV
TIQSLMRITPLRNFFLIPENYRHSKSPLVHRFGELTRKIWHARNFKGQVSPHEFLQAVMK
ASDKRFQIGVQSDPVEFMSWLLNTMHSKLKSRKRNRSIIHDCFQGELEVVKEFHKKHIVE
KKEDGDEQNGDAGSDIVTETSRVPFLMLGLDLPPPPLFKDAMEKNIIPQVPLFNILKKFD
GETVTEVVRPSIARMRYRVIRLPKYLILHMRRFTKNNFFVEKNPTLVNFPVKNLELKDYI
PLPKPKDSEKLRSKYDLIANVVHDGKPGEGCYRVFVQRKSEEAWYEMQDLHVTETLPQMV
ALSEAYMQIYEQHE
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggccgcggacgatctctcatccccggcgcggaagcgcggccgcgacgaggaggaggag
gaggaggaggaggtcatcgacggggaggccgcccagaagcgcgcgcgcggggaggatccg
gagggcggggcgctgctggggctcgccaactacgaggaggacgaggaggacgaggaggcg
gcggctgctgcggggaggcgccgcgcgaatggccgacacgaggaagaggaggaggaggac
gacgacgacgacgaggttgacaacgacgtgaggagggctccggagcggaggccgaggcaa
gtggagctgcgccgggactgcccttacctcgacaccgtgaaccgccaggtccttgatttt
gattttgagaagttctgctcaatctccttatcaaacttgaacgtgtatgcatgtttggtt
tgtggaaagtattaccaaggaagaggcttgaaatcacatgcatatactcacagccttgaa
gcaggccaccatgtgttcattaaccttcaaactgagaaagcttactgtcttcctgatgga
tatgagataaatgatccatcattggaagatattcgacatgttctcaacccaaggtttaca
acagagcaggttcgtaatcttgataggaacaagcagtggtctagagctcttgatggctcc
aattatctacctggaatggttggtctaaacaacatcaaggagacagattttgtgaatgtc
acaatacagtcattaatgagaattactcctttaagaaatttctttctcatccctgaaaat
tatcggcatagcaaatccccattggttcatcgatttggagaactaactcgcaaaatctgg
catgcaaggaacttcaagggccaggttagtccacatgagtttctgcaagcagttatgaag
gccagtgataagaggttccagattggtgttcagtctgatccagtggaatttatgtcatgg
ctcttgaacacaatgcactcgaaactaaaaagtaggaagagaaacagaagcatcatacat
gattgctttcagggagaacttgaagtagttaaggaatttcacaagaagcatattgtggaa
aagaaagaggacggcgatgaacagaatggtgatgcaggttcagatattgttactgaaaca
tctagggtcccatttttgatgcttggccttgacctaccacctccacctcttttcaaggac
gccatggagaaaaatatcattccacaggtaccactctttaatatattgaagaagtttgat
ggcgagacagttacagaggtagtgcgaccctccattgctcgtatgaggtatcgagtcatc
agacttccaaagtatctgatccttcacatgcgacggtttaccaaaaataacttctttgta
gagaagaatcctactctagtgaatttccccgtgaagaacttggaattgaaagattacatc
ccattacctaagccaaaagattccgagaagctacgctcaaagtatgatctcatagccaac
gttgtccatgatggcaagccaggcgagggatgttacagagtatttgtacagcggaaatca
gaagaggcttggtatgaaatgcaagatcttcatgttaccgagactcttcctcagatggta
gctctttcagaagcctacatgcaaatatacgagcagcacgaatga

DBGET integrated database retrieval system