KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347029
Entry
4347029           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4347029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4347029
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4347029
   03036 Chromosome and associated proteins [BR:osa03036]
    4347029
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M1
   4347029
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4347029
   Coactivators
    SAGA/TFTC/STAGA complex
     4347029
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     4347029
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 4347029
NCBI-ProteinID: XP_015611872
UniProt: B9G3J0
LinkDB
Position
9:14530902..14548031
AA seq 1503 aa
MAKARKQKGEEQKPDGGGAGGGGGGATVLHQKLCLSIDMENRLIYGYTEIKVQAENDTFA
LHADNMTIRNILVDGQAAEFEYSPQWKNAGDQQSWSSVSCSKTAADAACSVYISSLNSEA
APNLIISSERSSKAITEPQYEENGENHEENGEKHEENGEKQNENGEKCEENGGKPAQISD
DQAVNGCNGSADKKDKEEETEKDNEKEKEDKEEETEKDNEKEKEDKEEETKKDNEKEKEQ
LMGTDEKEKEKEKEDENEEEKLEEEEKKDKEEKLEEKEKENEEENGNEKDKENDNEIEKV
KNTKLVHIDYILEKAETGLYFTGNILHSNNQIRRAHCWFPCIDSATQRCPFDLEFTVSTN
LVAVSNGDLLYQVLSKEDPPRKTYVYKLSTPVSAQWISLVVGPFEVLPDRNDISVSHMCL
SQSLSKLENTISFFHSVYSCYEDYLAASFPFGLYKQVFLPPEMIVSPTSLGASTCIFNSD
ILHDEKVIDQIIDTRIKVAYALARQWFGIYTNAEEATDEWLLDGLAGFLTEHFVKRYLGN
NEARYRRFKANCIVCEFDVSGATALSSPSASSDLFGTQTIGSYGKIRSLKAVSVLQMLEK
QMGPDSFRKILQMIVAPTRASRTLSTKEFRHLANKVGNLERPFLKEFFPRWVESSGCPVM
RLGISYSKRRNLVELAVSRGCTTKVDPGPDIRTNGDSREGDTGWPGMMSVRVHETDGVYD
HPIVPMAGEALQVVEIQCHSKVAAKRFQKTKKGSKPDGSDENIDASNQDNRASMDAPLLW
IRVDPEMEYLAEIHFHQPVQMWINQLEKDKDVISQSQAISVLEKSPQLTFAVTNALNNFL
NDTKAFWRVRVEAAYALAVTASEGTELTGLLHLVKFYKSRRFDADIGLPRPNDFHDIPEY
FVLEAIPHAVALVRSADKSSPKEAIEFILQLLKYNDNNGNVYSDVYWLSAMVQAIGELEF
GQQGVGLLSSLLKRIDRLLQFDNFMPGYNGVLTVSCIRTLARIAQRVSSSICLDRVCELI
VPYRNMDKPWKVRMEAGRVLIDLEFHHKGLDAALLLFLKYANEERSLRGGTKLAVHVLRL
CQANIESHDNNQIQLPTLVGLLCLLAGKKAYNNVYLRHNVFCILQIAAGRSPTLHGVPKV
VTPPQVVLEISSDQHTKADSSVPQQSRPQEPSTSTPSVREVLPTSGPLKDADNISNCSER
RNVIFIPTKDADNISNCSERRNVISIPTKDADNISNCSERRNVVKIRVKRASSSSKADDA
DHRDHSHGRNENEAGPCSSMSVDAPMTEAPEPVNVSNHNIEEQNSCHDREQNSCHDRESR
MSASIGNVKLMDKHEVSKELQCTADSRLDALPKDHFSPVVNGQEVLDKPRSQLEVVSTSY
DGNQAPDSMNGLETKEKKKDKKDKKRHRDKKDDPEYLEKKRLKKEKKRMEKEKGKKQKEG
EGVSSSEQKNTAKPSDSQGTSSARPPAPMRIPEPKISNVGTPVDTTRTLTTTKIRIKVKP
LQR
NT seq 4512 nt   +upstreamnt  +downstreamnt
atggcgaaggcgaggaagcagaagggcgaagagcagaagcccgacggcggcggggctggc
ggcgggggagggggcgccaccgtgctccaccagaagctgtgcctctccatcgacatggag
aaccggctgatctatgggtacactgagataaaagttcaagctgaaaatgatacttttgct
ctgcatgctgacaacatgacgattaggaacatattagtggatggtcaagctgctgagttt
gagtattctcctcagtggaaaaatgctggtgatcaacagagttggtcttcagtatcatgt
tcgaagactgctgctgatgctgcatgctcagtatatatctcttctctaaatagtgaagct
gcacctaatctcatcatctcgtcagagagatcaagcaaggcaataactgagccacagtac
gaagaaaatggtgaaaaccacgaagaaaatggtgaaaaacatgaagaaaatggtgaaaaa
caaaatgaaaatggtgaaaaatgtgaagaaaatggtgggaaacctgctcaaatatctgat
gatcaagctgttaatggctgcaacggttctgctgataagaaggacaaagaagaggaaact
gagaaggacaatgaaaaagaaaaggaggacaaggaagaggaaactgagaaggacaatgaa
aaagaaaaggaggacaaggaagaggaaactaagaaggacaatgaaaaagaaaaggagcag
ctaatgggaactgatgagaaggagaaggagaaggagaaggaggatgagaatgaggaggag
aagttggaggaggaggagaagaaggataaggaggagaagttggaggagaaggagaaggag
aatgaagaggaaaatggaaatgagaaggacaaggaaaatgataatgaaattgaaaaggtg
aagaacacaaaactggttcacatagattatattttggagaaggctgaaactggactttac
ttcactggcaacatcttacatagtaacaatcaaataaggcgtgcacactgctggtttcct
tgcattgatagtgcaacacagcgctgtccatttgacctagagttcacagttagcacgaat
ctagttgctgtcagtaacggtgacttgctttaccaggtcttaagcaaggaagatcctcca
agaaaaacatatgtgtataaattgagcactccagttagtgcacagtggatatctttggtt
gttggtccatttgaagttcttcctgacaggaatgacataagtgtatcacacatgtgctta
tctcagagtttatcaaagcttgaaaataccatctcatttttccacagtgtctacagctgt
tatgaagattatcttgctgcatcatttccttttggactatacaaacaggtttttcttcca
cctgaaatgatagtatcaccaacaagcttaggagcttccacttgcatcttcaattcagat
atcttacacgacgaaaaggttatagatcagataattgacacgagaatcaaagtagcatat
gctcttgcaaggcaatggtttggcatatacacaaatgcagaggaggcaaccgatgagtgg
ttattggatggtttggctggttttctcactgagcattttgtcaagcgttatcttggcaat
aatgaggcacgatataggcgtttcaaggccaattgcattgtgtgtgagtttgatgtcagt
ggtgcaactgctttgagctctccttcagcttcaagtgatttatttggaactcaaacaatc
ggttcatatgggaaaattcgttctttgaaggcagtatctgttcttcaaatgttggagaaa
cagatggggccagactcttttcggaagattctgcagatgatagttgctccaactcgtgcc
tcaagaacactaagtacaaaagagttcaggcatcttgcaaacaaggtcggtaatcttgaa
cggccattcctgaaagaattcttcccaaggtgggttgaatcttctggatgcccagttatg
agattgggaatctcctatagcaagaggagaaacttggttgaattagctgtttcacgtggt
tgcaccacaaaagttgatcctggtcctgatattcgcacgaatggtgattctcgagaaggt
gatactggatggccaggaatgatgagcgtacgtgtccatgaaactgatggagtgtacgat
catccaattgtacccatggctggtgaagctttgcaggtggtggaaatacaatgtcattcc
aaagtagcagcaaagcgctttcagaaaactaaaaaaggctcaaagcctgatggttctgat
gaaaacatagatgcttcaaatcaagataaccgtgcgagtatggatgcacctttactgtgg
atcagagtggacccagaaatggagtatctcgctgagatacattttcaccagcctgtgcag
atgtggatcaatcaattggaaaaggacaaagatgtcatttcacaatcacaagcaatatct
gtactggagaaatcacctcaactcacttttgctgtgactaatgccctcaataatttctta
aatgatacaaaggcattttggagagttagagttgaagcagcatatgctttagctgtaact
gcatcagagggcacagaactaactggactgcttcatctggttaagttctataaaagccgc
cgatttgatgcagatattggattacccaggccgaatgacttccatgatattccggagtac
tttgttcttgaggcaattcctcatgcagtagctcttgttagatcagcagacaagagcagc
ccaaaagaagccattgaatttatccttcagcttctaaagtataatgataacaacggaaat
gtatactctgatgtctactggctatctgcaatggtgcaggcgataggtgaattagaattt
ggccagcagggtgtaggtctattgtcgtctcttctcaagcgcattgatcggctcctgcaa
tttgataactttatgcctggatacaatggggttttgactgtcagctgcattcgcaccctt
gcacgtattgcacagagggtgtcatcttccatttgccttgatcgcgtctgtgaactaatt
gtgccctatcgcaacatggacaaaccatggaaagttcgaatggaagctggcagggttctt
attgatctcgagtttcaccataaaggacttgatgcagctcttttattattcttgaaatat
gctaatgaagaaagatctttgagaggagggacaaagttggctgttcatgtcttgcgtcta
tgccaagccaatattgaatctcatgataataatcaaatacaattgccaactctagttggc
ctcctttgcctgcttgctggcaaaaaggcctacaacaatgtatatcttcgacataatgtg
ttctgcatattgcaaattgctgctggaaggtctccaacactgcatggagttccgaaggtt
gtcactccacctcaagttgtcctggagatatctagtgatcagcacactaaagctgattcc
tcagttcctcaacaatcaaggcctcaagaaccttccactagcactcctagtgtccgtgaa
gtcttacctacctctggacccttaaaagatgcggataatatatctaactgcagtgagaga
aggaatgttatttttatacccacaaaagatgcggataatatatctaactgcagtgagaga
aggaatgttatttctatacccacaaaagatgcggataatatatctaactgcagtgagaga
aggaatgttgtcaaaataagggttaaacgtgcttcatcatccagtaaagcagatgatgct
gatcacagagatcattcacatggtagaaatgaaaatgaagcaggtccatgtagctctatg
tcagtggatgcacctatgactgaagcaccagaaccagtaaatgtaagtaatcataacatc
gaggagcaaaactcatgccatgatagggaacaaaactcttgccacgatagggaatcaagg
atgtcagcaagcattggcaatgtcaaactaatggacaagcatgaagtatccaaggagcta
cagtgcacagccgattccaggctagatgctctccccaaggatcacttctctcccgttgtt
aatggacaggaagtcctagacaagccacggagtcagctagaagtagtctccacaagctat
gatggaaatcaagccccagactccatgaatggattggaaacgaaggagaagaagaaggac
aagaaagacaaaaagcggcatcgagataagaaagatgatcctgagtatctggagaaaaaa
cggcttaagaaagagaagaaaaggatggagaaagaaaaaggcaaaaagcagaaggaaggt
gaaggggtttcttcttccgaacagaagaacacagcgaaaccttcagactcgcaaggaacc
tcatcggcaaggccaccagctccaatgcgaattcctgaacccaagatatcaaatgtgggt
acgccagtagatactacacggacattgacaactactaagattaggatcaaagtcaagcct
ctgcaaagataa

DBGET integrated database retrieval system