KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347083
Entry
4347083           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 9
  KO
K06693  26S proteasome regulatory subunit N4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4347083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4347083
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4347083
SSDB
Motif
Pfam: Nas2_N PDZ_2
Other DBs
NCBI-GeneID: 4347083
NCBI-ProteinID: XP_015612587
UniProt: Q0J1Q4 Q69Q88
LinkDB
Position
9:complement(15153762..15157036)
AA seq 213 aa
MVATNLKAETVGLMDRRAAVEAEMDAIIAALSVPVGPGITGGLVDAEGFPRSDIDIPAVL
AQRRKLAELRNDHKDITNKIEKNLEVLHSTKLSRNEASIPASSGTPASLHSGLSQNDPME
EDAVTRLPFAIIDELTDGSPAAVDGLQLWDEIVKFGNVEAGDRLQERLVSEALSNEDCQV
SLVIIRQGSSMNLTVTPRKWHGRGLLGCHFRIL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtggcgacgaacctgaaggcggagacggtggggctgatggaccggcgggcggcggtg
gaggcggagatggacgccatcatcgccgccctctccgtgcccgtcgggccggggatcacc
ggcggcctcgtggacgcggagggtttccccaggtccgacatcgacatcccggccgtcctc
gcccagcgccgcaagctcgccgaattgcggaatgatcacaaggatattacgaacaaaatt
gagaagaatctggaagttttgcactcaacaaaattgtcaagaaatgaagcgtcaatccct
gcaagttctggcacacctgcttcattgcacagtgggttatctcaaaatgatcctatggaa
gaagatgctgtgaccagacttccttttgccataattgatgaactgacagatggttctcct
gctgctgtggatggcttgcagctttgggatgagatagtaaagtttggaaatgtggaagca
ggtgatagattgcaagaaaggcttgtctctgaagctctttccaatgaggattgtcaagta
tctctagtcatcattcgtcagggatcatcaatgaacttaactgttacaccaagaaagtgg
cacggaagaggacttttgggatgccatttccgaatcttatga

DBGET integrated database retrieval system