KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347604
Entry
4347604           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4347604
  KO
K03505  DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4347604
   03410 Base excision repair
    4347604
   03420 Nucleotide excision repair
    4347604
   03430 Mismatch repair
    4347604
   03440 Homologous recombination
    4347604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4347604
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347604
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4347604
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4347604
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4347604
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 4347604
NCBI-ProteinID: XP_015651399
UniProt: Q64MB0 A3C0Q3
LinkDB
Position
9:complement(20313567..20315721)
AA seq 131 aa
MASGGMKDFYRQKKKGGPTKASSSSKKKTQHYTGGASVGASDTAQTSALISHGNLDLKDD
FSEQEEQLRLFDMDMKFGPCIGVTRLQRWERASAMGLHPPPHLRDLLLNNTHAGNHNNNG
PSLECLWEGKV
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcttctggtggcatgaaggacttttaccggcagaagaagaaaggaggtcccaccaaa
gcatcgtcatcttccaagaagaaaacacagcattacactggaggggcctctgttggggcc
tcagacactgctcagacatcagcactaatttctcatggtaacctagatcttaaagatgat
ttcagtgagcaagaggagcagttgcgactgtttgatatggacatgaagtttggcccttgc
attggcgttactcgtcttcagcgttgggaacgtgcttctgccatgggtcttcacccacca
cctcatctcagggatctcttactgaacaatactcatgcaggcaatcacaataacaatggt
ccctcccttgagtgcctctgggagggcaaagtctag

DBGET integrated database retrieval system