KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347672
Entry
4347672           CDS       T01015                                 
Name
(RefSeq) protein STAY-GREEN, chloroplastic
  KO
K22013  magnesium dechelatase [EC:4.99.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4347672
Enzymes [BR:osa01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.10  magnesium dechelatase
     4347672
SSDB
Motif
Pfam: Staygreen
Other DBs
NCBI-GeneID: 4347672
NCBI-ProteinID: XP_015611682
UniProt: Q652K1
LinkDB
Position
9:complement(20868717..20871234)
AA seq 274 aa
MAAATSTMSLLPPITQQQRWHAADSLVVLASRCHNSRRRRRCRYVVPRARLFGPAIFEAS
KLKVLFLGVDEEKHQHPGKLPRTYTLTHSDVTARLTLAVSHTINRAQLQGWYNKLQRDEV
VAEWKKVQGHMSLHVHCHISGGHVLLDLIAGLRYYIFRKELPVVLKAFVHGDGNLFSRHP
ELEEATVWVYFHSNLPRFNRVECWGPLRDAGAPPEEDDAVAAAAAEEAAAEQMPAAGEWP
RRCPGQCDCCFPPYSLIPWPHQHDVAAADGQPQQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atggctgctgctacttcgaccatgtccctgcttcctcccatcacccagcagcagcggtgg
cacgccgccgactccctcgtcgtcctcgcctcccgctgccacaactctcgccgccgccgc
cgctgccgctacgtcgtgccgagggcgaggctgttcgggccggcgatcttcgaggcgtcg
aagctgaaggtgctgttcctgggggtggacgaggagaagcaccagcacccggggaagctg
ccgcggacgtacacgctgacgcacagcgacgtgacggcgaggctgacgctggcggtgtcg
cacaccatcaaccgggcgcagctgcaggggtggtacaacaagctgcagcgggacgaggtg
gtggcggagtggaagaaggtgcagggccacatgtcgctgcacgtccactgccacatctcc
ggcggccacgtcctcctcgacctcatcgccggcctccgctactacatcttccgcaaggag
ctccccgtggttctgaaggcgttcgtccacggcgacggcaacctgttcagccggcacccg
gagctggaggaggccacggtgtgggtctacttccactccaacctcccacgcttcaaccgc
gtcgagtgctggggcccgctccgcgacgccggagcgccgcccgaggaagacgacgccgtc
gccgccgcggcggccgaggaggcggcggcggagcagatgcccgcggccggcgagtggccg
cggcggtgcccggggcagtgcgactgctgcttcccgccatacagcctcatcccctggccg
caccagcacgacgtcgccgccgccgacggccagccgcagcagtga

DBGET integrated database retrieval system