KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347674
Entry
4347674           CDS       T01015                                 
Name
(RefSeq) two-component response regulator-like PRR95
  KO
K12130  pseudo-response regulator 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4347674
SSDB
Motif
Pfam: Response_reg CCT Jas_motif DUF362 RELT
Other DBs
NCBI-GeneID: 4347674
NCBI-ProteinID: XP_015611684
UniProt: Q689G6
LinkDB
Position
9:complement(20885172..20889846)
AA seq 623 aa
MGGGVEERKVVDLEDGDGEEGEDAAAVAAGSSRETRMLPRMPVRVLLAEGDDSTRHIICA
LLRKCGYRVAAASDGVKAWDILKEKSFNIDLVLTEVELPLMSGFLLLSTIMEHDACKNIP
VIMMSSNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWRKQLSSGVLDVQHTQQED
NLTERHEQKTGVTKAEHVTENVVHKNMECSEQESDAQSSCTRSELEADSRQTNNLLEYKQ
PMGRHFSKPDHKNTEKNGGTKIHASNDGNLIPRREEDASLRRMTCSNDINCEKASRDMEL
VHIIDNQQKNNTHMEMDVARANSRGNDDKCFSIPAHQLELSLRRSDYSRLESQEKNERRT
LNHSTSSPFSLYNCRTASSTINAGDAQACSTSATHIDLENKNGDSKTPSQDKRETNQPPI
RVVPFPVPVGGLTFDGQPFWNGAPVASLFYPQSAPPIWNSKTSTWQDATTQAISLQQNGP
KDTDTKQVENVEEQTARSHLSANRKHLRIEIPTDEPRHVSPTTGESGSSTVLDSARKTLS
GSVCDSSSNHMIAPTESSNVVPENPDGLRHLSQREAALNKFRLKRKDRCFEKKVRYQSRK
LLAEQRPRVKGQFVRQDHGVQGS
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggggggtggagtggaggagaggaaggtggtggacttggaggacggggacggggaggaa
ggggaggatgcggcggcggtggcggcggggtcgagcagggagacgcggatgctgccgagg
atgccggtgcgggtgctgctcgctgagggcgacgactccacgcgccacatcatctgcgcg
ctgctccgcaagtgcgggtatcgagttgccgcagcctctgatggtgtgaaagcgtgggac
atactaaaggaaaaatctttcaatatagaccttgttttaactgaagttgaacttcccttg
atgtctgggttcctgctgctctccacgatcatggaacatgacgcatgcaagaatatcccc
gtcataatgatgtcttcaaatgattccgttagcatggttttcaaatgcatgctaaagggt
gctgcagatttccttgttaagccaatacggaagaatgaattaaggaacttatggcagcat
gtttggagaaaacaactgtccagcggtgttcttgatgtgcagcatactcaacaagaagat
aatcttacagaaaggcatgagcagaagaccggagtgacgaaagctgaacatgtgactgaa
aatgttgtccacaagaacatggaatgcagtgaacaagaaagtgatgctcaaagttcatgt
acaaggtcagaactggaggctgacagtaggcaaaccaacaatttactggaatataagcag
ccaatgggaaggcatttctccaagcctgaccacaagaacaccgagaaaaatggagggact
aaaattcatgcatctaatgatggcaacttgattccacggagggaagaggatgcatcactg
aggaggatgacatgttcaaatgatattaattgtgagaaagcttccagggatatggagctg
gttcatattattgacaatcagcagaagaataacacacatatggagatggatgttgcgaga
gcaaattcccgtggaaatgatgacaagtgcttttccattccagcacaccagttagaactt
tctctcagaagatctgactacagtagattagagagccaggagaaaaatgaacgaagaaca
ctgaaccactcaacttcatctccattttccttgtacaactgcaggacagcatcatctacc
attaatgctggtgatgctcaggcatgcagcacctcggcaacacatatagatcttgaaaac
aaaaatggagattccaaaactccctctcaagacaagagggaaacaaaccaacctcccatt
agagttgtaccatttcctgttcctgttggaggactaacatttgatgggcagccattctgg
aacggtgcacctgtggcatcccttttctatccacaatcagctcctcccatttggaatagc
aaaacatctacctggcaagacgcaaccacacaagcaatttctctgcagcagaatggtcca
aaagatacggatactaagcaggttgaaaatgtagaggaacaaactgctcggagtcatcta
agtgctaatcggaaacatctccgcattgaaattcctacagatgagccgcggcatgtttct
ccaaccaccggtgaaagtgggagcagcactgtgctggacagcgccagaaaaacgctcagt
ggcagtgtctgtgacagctcttccaaccacatgattgcccctactgaatcatcaaatgtt
gttcctgaaaatcctgatggtttacgccacctgagccaacgagaggctgcactgaacaag
ttccggcttaagaggaaagacaggtgctttgagaagaaggtgcgataccagagcaggaag
ctactagccgagcagcgaccgcgggttaagggtcagtttgttcggcaagatcatggtgtc
caagggagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349831
Entry
4349831           CDS       T01015                                 
Name
(RefSeq) two-component response regulator-like APRR3
  KO
K12130  pseudo-response regulator 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4349831
SSDB
Motif
Pfam: Response_reg CCT DUF5000 Jas_motif
Other DBs
NCBI-GeneID: 4349831
NCBI-ProteinID: XP_015617753
UniProt: Q2RAB7
LinkDB
Position
11:2788992..2793733
AA seq 699 aa
MSPDADAAAAAAAGGEGAAAAGVGTAGEGRGVIRWDQILPRRSLRVLLVEHDDSTRQVVT
ALLRKCGYRVAAVADGMKAWGVMRERAYAFDLVLTEVTMPTLSGIELLSRIVASDECKNI
PVIMMSSQDSIGTVLRCMQKGAVDFLVKPVRKNELRNLWQHVWRRHAMNSQTNASENNAA
SNHLSANGGNGSKTGEHSDEESDAQSSGSKREVEIQSAEKLPEVVADGGAGSSREHKIQN
GFIDGMNTKSHALKGNDDAPSGNACGDSELQVLSTEKNVRSKFLNGITSAKVAGQIMDNA
LRFADSSSLRSSDPGKDLLVVAQTTADRKCKSSALENNAVMENNLSENSKGTATGHAESC
PSHFVEINLEKQHHLNGYTNHKLNEKDIFNHSNSSAFSRYGNKRIESSAQRPFPPSFRVV
HQQPVYDKNPQSSRVLLSCEHNTRESTVQAQVPLDRSTEGAAILCSSSVREDAGTSSSSP
RKDSLTHPSYGFIPVPIPVGAAIPYHYGAIMQPMYYPQGAFMHCDSAAINKTAIQHVSCQ
SNYHENLGKPPQIDEHKQPEENHQLHHSRQILRESGEPVDLAKAHMERINQSASCSQDIR
KGSGCTGSGETDANTNTVIALESGNESGVQNCSNNVLDGDRSRREAALLKFRMKRKDRCF
EKKVRYHSRKKLAEQRPRVKGQFVSQKLKSAITTEAETD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgtctcccgacgccgacgcggcggcggcggcggcggccggcggcgagggcgcggcggcg
gcgggggtggggacggcgggtgaagggcggggggtgatccggtgggaccagatcctgccg
cggcggtccctccgcgtgctgctcgtcgagcacgacgactccacccgccaggtcgtcacc
gcgctcctccgcaagtgcggctaccgcgtggcggcggtggcggacgggatgaaggcgtgg
ggggtgatgcgggagcgggcgtacgccttcgacctcgtgctcacggaggtcactatgccc
acgctctccggcatcgagctgctctccaggatcgtcgcctccgacgagtgcaagaacatc
cccgtcataatgatgtcgtcccaagattctattggcacagtgctcaggtgcatgcagaag
ggtgcggtggatttccttgtgaaaccagtgagaaagaatgaattgcgtaacttatggcaa
catgtatggaggcgacatgcaatgaatagccaaacaaatgcatcggaaaacaatgcggct
agcaatcatttaagtgccaatggtggtaatgggtcaaagacaggagaacacagcgatgag
gaaagtgatgctcagagttctggtagcaaaagggaggttgaaattcaaagtgctgaaaag
ttaccagaggttgttgcagatggtggggcaggctcatccagagaacataaaatacagaat
ggtttcattgatggaatgaacacaaaatcacatgcattaaagggtaatgatgatgctcca
agtggaaacgcgtgtggtgatagtgaactacaagtgctttcaactgagaagaatgtgcgt
tccaaattccttaatggtattacttctgcgaaggttgctggacagataatggataatgcc
ttgaggtttgctgattcaagttcacttcgttcaagtgatcctggaaaagatcttttggtt
gttgcccagaccacagctgacagaaaatgcaaatcttcagcactggaaaataatgctgtc
atggaaaataaccttagtgaaaattcaaaggggactgcaacaggccatgctgaatcttgt
ccgtctcactttgtggagataaatttagaaaagcaacatcatctcaatggttatacaaac
cacaagttgaatgagaaagatatctttaatcactcaaattcctctgccttttcgaggtat
ggtaataagaggatagaatcatcagctcaacggccatttcccccttccttccgcgtggtt
caccaacaacctgtttacgacaagaatccccaatccagccgggtcttgctttcctgtgaa
cataatacacgcgagagtacagtgcaagctcaggtccctttggacagaagcacagagggt
gctgcaatcctgtgttccagtagtgtaagagaagatgctggtacaagcagttcctctcct
agaaaggacagtttaactcatccttcttatgggtttatacctgttccaattcctgttggt
gctgctataccctaccactacggtgcaattatgcagccaatgtattatccacagggtgct
tttatgcattgtgattcagctgccatcaacaagacagcaattcagcatgtctcttgtcaa
tctaactaccatgaaaatcttggtaaaccgccacagattgatgagcacaagcagccagaa
gaaaaccatcagttgcatcattcaagacaaattctccgagaatcaggagaaccagttgac
ttggcgaaggctcatatggagcgtattaaccagagtgctagctgtagccaggatattcgc
aaaggaagtggatgcactgggagcggtgaaactgatgcaaatacaaatacggtaattgca
ctagaaagtggcaatgagagcggtgtccagaactgcagtaataatgtattggatggtgac
cggtctcgccgtgaagctgccttgttgaaattccggatgaaaagaaaagatagatgtttc
gagaaaaaggtcaggtatcatagcaggaagaagcttgcagaacaaagacccagggttaag
ggccagtttgtgagccaaaaactgaagtcagctataacaacagaggcagaaactgactag

DBGET integrated database retrieval system