KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347697
Entry
4347697           CDS       T01015                                 
Name
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase 2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4347697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347697
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4347697
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     4347697
SSDB
Motif
Pfam: Exo_endo_phos zf-GRF
Other DBs
NCBI-GeneID: 4347697
NCBI-ProteinID: XP_015612024
UniProt: Q69JZ1 Q0J018
LinkDB
Position
9:complement(21063900..21068759)
AA seq 619 aa
MVKIVTYNVNGLRPRVAQHGSLRRLLDALDADIICFQETKLSRQDLSGDVIMAEGYEAFI
SCNRSSKGRGAYSGVATFCRVTSAFSSQEVALPVAAEEGFTGLQETAKNSETIGDFVLVT
PVEEEGLGEVTKEELLKVDNEGRCVITDHGHFVLFNIYGPAVEEDDIERVRFKLLFYKIL
QRRWEHLLALGKRVFVVGDLNIAPSSIDRCDAQPGFEKQTFRKWLRSMLREHGGPFFDAF
RSKHPERVGAYTCFNQKVGAEVYNYGSRIDHILISGACFHHCGSVDDHSIFPCHVEECEI
MDHFRRGNSENMSMWKGGRSSKLEGSDHIPVYIVLNEIPELPVHNTPSSAARYLPEIRGR
QQSIVSFLRKGMIYEHKDAMSMDRADESCCGGGLERKAIYKEEPPTDIAKFSKGNDLHSV
IKRKIRDQLLNEGSSGNSHNSTAALLATQSRKASFSCSKAVSNKKNKHNLSSQPTIKSFF
QQPKSKPGDSSTNSIVTPPDTLHGMDELHDPKNDCLPESIQCTTPATEDQGNSDVPCSLS
TDKCNEATLEWQRIQQRMKMTLPLCKGHHEPCIPRSVKKGSNIGRLFYVCARAQGPASNQ
EANCGHFQWATVKSKEKRR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggtgaagatagtgacgtacaacgtgaacgggctgcggccgcgggtggcgcagcatggc
tcgctccgccgcctcctcgacgccctcgacgccgacatcatctgcttccaggagacaaaa
ttgtcgaggcaggacttgtcgggggatgtcatcatggctgagggatacgaggcttttatt
tcatgcaatcgttcatcgaaagggcgtggagcttactctggtgttgccacgttttgccgg
gtaacatcagccttttccagtcaagaggttgctttaccagtagcagctgaggaaggcttt
actggattgcaagagactgcaaagaacagtgaaactattggggattttgttcttgtaact
cctgtggaagaggaaggtcttggtgaagtaacaaaagaagagctgctcaaggtggacaat
gaaggacgttgtgtaattacagatcatggacattttgttctttttaatatatatggccca
gctgttgaagaagatgatatagaacgagttcgctttaagctactattttacaagatacta
cagagaagatgggaacatttgttggctcttgggaaaagagttttcgttgttggtgatttg
aatattgcaccttcttcaatagataggtgtgatgcccaacctggattcgagaagcaaacg
tttcggaaatggttgagatccatgctgagagaacatggaggtccattttttgatgctttc
cgatcaaaacaccctgaaagagtgggagcttatacctgttttaatcaaaaagttggagct
gaagtatacaattatggttctagaattgatcacattctcatttctggtgcctgcttccat
cactgcggttctgtggatgaccacagcatctttccctgccatgtggaagaatgtgaaatt
atggatcatttcagaagagggaatagcgaaaatatgtcaatgtggaaaggagggagaagt
agtaagctagaaggatcagatcatattccagtttatattgtgctgaatgagatacctgaa
cttccagttcataacactccttcatcagctgctagatatcttcctgaaatccgtggacgg
caacagagcatagtatcattcctaaggaaaggcatgatttatgaacataaagatgccatg
tccatggatagagcagatgaaagctgctgtggtggtggcttggaaaggaaagctatatat
aaggaagaaccaccaactgatatagccaaattttccaaaggtaacgaccttcatagtgtc
atcaagcggaaaattcgtgatcaattgttaaatgaaggttcaagtggcaactcccataat
agcactgcagcattactggcaacacaaagtagaaaagcttccttttcttgcagcaaggct
gtgtccaacaagaaaaacaaacataacttgtcttcccaacctacgatcaagtcatttttt
caacaaccaaagtcaaagccaggagatagcagtaccaatagcatagttactccaccagat
actttgcatggtatggatgaattacatgatccaaagaatgactgtctgccagaaagcatc
cagtgtacaactccagcaaccgaagatcagggtaactcagatgtaccctgctcgctttca
acagataaatgcaatgaagcaacactggagtggcaaagaatacagcagagaatgaagatg
accctaccactttgcaaaggacaccatgaaccttgcattccaaggtctgtgaagaaaggc
tctaatattggtcgcctattctatgtctgtgcccgtgctcagggacctgcatcaaaccaa
gaagcaaattgtggtcactttcagtgggccactgttaagtctaaagagaaacgccggtga

DBGET integrated database retrieval system