KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347717
Entry
4347717           CDS       T01015                                 
Name
(RefSeq) 3-dehydroquinate synthase, chloroplastic
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4347717
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     4347717
SSDB
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Other DBs
NCBI-GeneID: 4347717
NCBI-ProteinID: XP_015612522
UniProt: A3C117 Q651F0
LinkDB
Position
9:complement(21225956..21229360)
AA seq 443 aa
MAAAASSSLLAAASSSSRAAAVSARRAPSASPAAAASLPSPSRASCAPPLRASAARTLRS
RVVASAAPAMQPPPASRVSTVVDVDLGDRSYPIYIGAGLLDEPDLLQRHVHGKRVLVVTN
TTVAPLYLEKVTWALTHNNPNVSVESVILPDGEKYKDMGTLMKVFDKAVESRLDRRCTFV
ALGGGVIGDMCGFAAAAFLRGVNFIQIPTTLMAQVDSSVGGKTGINHPLGKNLIGAFYQP
QCVLIDTETLNTLPDRELASGIAEVVKYGLIRDAPFFEWQEKNMPALLAREPSALAYAIK
RSCENKAEVVAQDEKESGLRATLNLGHTFGHAIETGTGYGAWLHGEAVAAGTVMAADMSH
RLGWIDESIKKRAIDILEKAKLPITPPEAMTVEKFKSIMAVDKKVADGLLRLILLKGPLG
SCVFTGDYDRNALDETLRAFCDC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggcggccgccgcctcctcctctctgctcgccgccgcctcgtcgtcctcccgcgcggcg
gccgtgtccgcccgccgcgcccccagcgcgagtccggccgcggcggcctccctcccctcg
ccgtctcgcgcctcctgcgctcctcccctccgcgcttccgcagcgaggaccctccgcagc
cgtgtcgtcgcgagcgcggcccccgctatgcagccgccgccggcgtcgagggtctccacg
gttgtcgacgtcgacctcggcgaccggagctacccgatctacatcggcgcaggccttctc
gacgagcctgacctgctgcagaggcatgttcatgggaagagggttttggtggtgaccaac
accaccgtcgcgccgctctacctggagaaggtgacctgggcactcacgcacaacaacccg
aatgtttctgtggagagcgtgatcctgcccgacggcgagaagtacaaggacatgggcaca
ctgatgaaggttttcgacaaggcagtcgagtcccggctggaccggcggtgcacgtttgtt
gcgttgggaggtggcgttattggggacatgtgcggttttgcagctgctgcgttcctgcgt
ggtgtcaatttcatacagattcctactactctgatggcccaggtggattcatctgttgga
gggaagaccggcattaaccatccattggggaagaacttaattggggcgttctaccagcca
cagtgtgtactgatagacaccgagacactgaatacattgcctgacagggaactggcttca
ggcatagctgaggtggtgaagtatggtctcataagagatgcaccgttctttgaatggcaa
gagaaaaacatgccagcattattagcaagagaaccaagtgctctggcctatgctattaag
agatcgtgtgaaaacaaagctgaagtggttgctcaggacgagaaggaaagtggtctccga
gcaacacttaatctcggccatacatttggccatgctatagaaacaggaactggttatgga
gcatggctccatggggaggctgttgcagctggaacagttatggcagctgacatgtctcac
cgcctgggttggatagacgagtcaatcaagaaacgggcaattgacatactagagaaagcg
aagcttccaattacacctccagaggccatgacagtggagaagttcaaaagtattatggcc
gttgataagaaggttgctgatggattgctgaggctcatcctcctgaaaggacctctggga
agctgtgttttcactggcgattacgacaggaatgccctcgacgaaaccctccgtgcattc
tgcgactgctga

DBGET integrated database retrieval system