KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347746
Entry
4347746           CDS       T01015                                 
Name
(RefSeq) ornithine decarboxylase 1B, chloroplastic
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04148  Efferocytosis
Module
osa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4347746
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4347746
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    4347746
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     4347746
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC AP_endonuc_2
Other DBs
NCBI-GeneID: 4347746
NCBI-ProteinID: XP_015610876
UniProt: Q7XJ04
LinkDB
Position
9:complement(25851348..25852592)
AA seq 414 aa
MVGGSPMQAVLMAPGVKDKKVLAFKRGKGKDADAGVTALIRDIVAGGARSAFHVFDLAKV
VDLHRGWRRALPDVRPCYAVKCNPDGAMLAALAALGAGFDCASRAEIEAVLALGVRPATI
VYANPCKPEAHLEYAAEVGVNLTTYDSEEEVAKVRRCHPRCELLLRIKAPDSGDAKVDLG
LKYGANPDEVLPLLRAAQREGVAVAGVSFHVGSGASRADVYRGAIEAAREAFDAAAALGM
PPMRVLDIGGGFMAGRTFDEAAAVINRALERHFGDLPCVEVIGEPGRYFAETAFTLAARV
IGKRTRGELREYWIDDGLYGSLNCILMDHYVPRPRPLAAAAAGEDTTAATTHASTVFGPT
CDSLDTVVTGYQLPEMSVGDWLVFDDMGAYTTAAGSNFNGFATSAIKIHLAYSS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggttggaggaagccccatgcaggccgtgctcatggcccccggcgtcaaggacaagaag
gtgctcgccttcaagcgcggcaagggcaaggacgccgacgccggcgtcacggcgctcatc
cgcgacatcgtcgccggcggcgcccggagcgcgttccacgtcttcgacctcgccaaggtc
gtcgacctccaccgcgggtggcgccgcgcgctccccgacgtgcgcccctgctacgccgtc
aagtgcaaccccgacggcgccatgctcgccgcgctcgccgcgctcggcgccggcttcgac
tgcgccagccgcgccgagatcgaggcagtgctcgcgctcggcgtccgccccgccaccatc
gtctacgccaacccgtgcaagcccgaggcgcacctcgagtacgccgccgaggtcggcgtc
aacctcaccacctacgactccgaggaggaggtggccaaggtccggcgatgccacccgcgc
tgcgagctgctgctccgcatcaaggcgcccgactccggcgacgccaaggtcgacctgggg
ctcaagtacggcgccaacccggacgaggtgctaccgctcctccgcgccgcgcagcgcgag
ggcgtcgccgtcgccggcgtctccttccacgtcgggagcggcgcgtcccgcgccgacgtc
taccgcggcgccatcgaggcggcgcgcgaggcgttcgacgccgcggcggcgctcggcatg
ccgccgatgcgcgtcctcgacatcggcggcggcttcatggccggccggaccttcgacgag
gcggcggcggtcatcaaccgcgcgctggagcgccacttcggcgacctcccctgcgtcgag
gtgatcggcgagcccgggcggtacttcgccgagacggcgttcaccctcgccgcgcgcgtc
atcgggaagcgcacccgcggcgagctccgggagtactggatcgacgacggcctctacggc
tccctcaactgcatcctcatggaccactacgtgccgcgcccgaggccgctcgccgccgcc
gccgccggcgaggacacgacggcggcgacgacgcacgcctcgacggtgttcggcccgacg
tgcgactccctcgacacggtggtcaccggctaccagctgccggagatgagcgtcggcgac
tggctcgtgttcgacgacatgggcgcctacaccaccgcggctggctccaacttcaacggc
ttcgccacgtcagcgataaagatccacctggcatactccagctag

DBGET integrated database retrieval system