KEGG   Oryza sativa japonica (Japanese rice): 4347791
Entry
4347791           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MLH3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 HBB
Other DBs
NCBI-GeneID: 4347791
NCBI-ProteinID: XP_015612513
LinkDB
Position
9:complement(join(26313293..26313481,26313617..26313702,26313791..26313863,26314093..26314152,26314713..26314761,26315154..26315257,26315413..26315466,26315545..26315589,26316241..26316441,26316515..26316623,26316726..26316819,26316901..26318304,26318386..26318430,26318536..26318614,26318838..26319055,26319152..26319167,26319250..26319415,26319505..26319597,26319698..26319755,26319889..26319946,26320036..26320193,26320956..26321003,26321095..26321146,26321230..26321355))
AA seq 1194 aa
MQTIKRLPKSVHSSLRSSIVLFDLSRVVEELVYNSIDANASKIDISVNARACYVKVEDDG
CGITRDELVLVGEKYATSKFHNVMVDGEPSSRSFGLNGEALASLSDISVVEVRTKARGRP
NSYCKIIKGSKCSHLGIDEQREVVGTTVIVRELFYNQPVRRKQMQSSYKRELHLVKKSVL
RVALIHPQVSLRLFDIESEDELLYTIPSSSPLPLVSNILGKNVSSCLHEIATSDKHFALS
GHISRPTDVFCNKDFQYLYINSRFVSKSPIHNMLNNLASSFQSSARNEEIDVRSKKRQKN
EVYPAYLLNLCCPRSSYDLHFEPSQTIVEFKDWQTVMYFFERTITDYWKKHAPQLPEVKA
IGNDTCVPLERDVKSSQELLRRHGVQKKEDVAELYQTALQKNTVRDMNFDTAAPAEPKDN
YLSLDMEPSTWRACYDQISDASHTDDVARNGRKFGHKQICSLQSYSYQWLEDGSSLLEDS
DLSSANPTICKMQKTEDIFHGHAYSGKFGLLQDAEIEIGPEIKLQEYCFESPNKPNRMTC
DFVQKQTNIEAHISGRDGFYVDFDKLNEDCLLNEISKTITDVSCPQMPHFNDGLCPEDVG
SSKSSCSVRKKSSKRQNSANAIAQMKFHDMQAVCESDYMDRSFIKDTCGLHFFHPFSLAD
TPRSHSRARIDLELHGRSNESINSWNCENIGTDFGFTSDRFNIDSSMIFEGSKHLNNFGN
GTQSPSYFNHEYCSVGQFASKQDRIPLKSKHDARMSYDISPEKSSTGCHLNVSFSQVAKS
SKLTEDQYGCSQRPRLSRGRYRSRSAPPFYRGKRKFPRLNEPLTKLTTEGGKYTTVNDSG
DITPVQEYTSHMNATQPIPETFSNDFSDLNFSLKGNVKMCEEKCSDELEDSTASDEITKW
RDDSDHHAVSELQHGPFEHDDDVLSISYGPLHLSCSVLVPECIDKNCFEEARVLLQLDKK
FIPVISGEVLLLVDQHAADERIRLEELRRKVLSDDGRGITYLDSEEDLVLPETGFQLFQK
YMQQIQSWGWIINSTNSCESFKKNMNVLRRQSRRLTLAAVPCILGVTLTGKDLMDFIQQL
DDTDGSSAIPPAVIRILNFKACRGAIMFGDPLLPSECSLIIEELKATSLCFQCAHGRPTT
VPIVNVASLRGELARLGAVNGRQEETWHGLSHHGPSLERARTRLRELRKLRGGL
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgcagacaataaaacggttgccaaaaagtgtccatagctcgttgcgctcaagcattgtt
ctatttgacctatcaagggttgttgaggagctggtatataatagcattgacgcaaatgcg
agcaagattgacatctcagtgaatgccagagcatgttatgttaaagtggaagatgatggc
tgtggtattactcgtgacgaactggttcttgtaggagaaaaatatgcaacatccaagttt
cataatgtcatggttgatggggaacctagttccagaagttttggattaaatggcgaagca
ctcgcatcactatctgatatctctgttgttgaagtcaggacaaaagctcgcgggcgacca
aattcatattgcaagataataaagggatccaaatgctcacacctgggaatagatgagcag
agggaagttgttggaaccacagttattgttcgcgagcttttttacaatcaacctgtacgc
aggaaacaaatgcaatctagttacaaaagagaactacatcttgtgaagaagtctgttctg
cgagttgcactcattcatccacaagtttcactcagactttttgatattgagagtgaagat
gagttgctatacacgattccttcatcctcccccttgcctcttgtatcaaacattttgggg
aaaaatgtctccagctgtcttcatgagatagctacctctgacaagcattttgctctttca
gggcacatctccagaccaacagatgtgttctgtaataaggatttccagtacttgtatatc
aactcaagattcgtcagtaaaagcccaatccacaatatgctcaataacctggcatctagt
tttcaatcttctgcaaggaatgaggaaattgatgttcggagtaagaagaggcagaagaat
gaagtctaccctgcatatctgctaaacttgtgctgtcctagatcaagctatgatctacat
tttgagccttcacagactattgtggaattcaaggattggcaaactgtcatgtatttcttt
gaacgaactatcacagactattggaagaagcatgcacctcaactgccagaagtgaaagct
attggcaatgatacctgtgtgcctttggaaagagatgtgaaatcaagtcaggaactgtta
aggcgtcatggtgtgcagaagaaagaagatgtcgctgaattgtaccaaacagctctgcag
aagaatacagtacgagacatgaattttgatacagctgccccagcagaacctaaagacaat
tacctttctttggatatggagccatccacatggcgtgcctgctatgaccagatcagtgat
gcatcccacacagatgatgttgctaggaatggtcggaaatttggtcataagcaaatatgt
tcccttcaaagttatagttatcagtggttagaggacggctcttccctgttagaagactct
gatctttcaagtgctaacccaactatttgtaaaatgcaaaagacagaagatatattccat
gggcatgcatattctggtaagtttggactgctacaagatgcagaaatcgaaatcggtcca
gaaattaaactccaagaatattgctttgaatctcccaataaaccgaacagaatgacctgc
gattttgtgcaaaagcaaaccaatatagaggcacacatttcaggccgtgatggattctat
gttgattttgataaattgaacgaggactgtctactcaatgagatatcaaagacaatcact
gatgtttcctgccctcaaatgccacactttaatgatggactctgtcctgaggacgttggc
tcctccaagagttcctgtagtgtcaggaaaaagtctagtaaaaggcaaaatagtgctaat
gcaattgcccagatgaagttccatgatatgcaagcagtttgcgaaagtgattacatggat
aggtccttcatcaaggatacatgtggccttcatttctttcatccattctcgttggctgat
acacctcgcagtcacagtcgtgcaaggattgacttggaattgcatggaaggtcaaatgaa
agcattaacagttggaactgtgaaaatattggcactgattttggatttacttcagacagg
tttaatattgattcatcaatgatttttgaaggaagcaaacatctcaataactttggcaat
ggaactcaatctcctagttacttcaatcatgaatattgttctgtcggtcagtttgcttcc
aaacaggatcggatacccttgaaatcaaaacatgatgcaagaatgtcatatgatatttct
cctgagaaaagttctactggttgtcatttgaatgtttctttttcccaagtggcaaaaagc
agcaagcttactgaagatcagtatggatgcagtcagaggcccaggctttccagaggtaga
tataggagtcgttctgcaccaccattttacagaggcaaaagaaaattccctagattaaac
gaaccactaaccaaattgactacagaaggtggtaaatataccactgttaatgactcagga
gatatcacacctgttcaggagtatacatcacatatgaacgcaacccaacctattcctgag
acctttagcaatgacttttctgacctaaatttcagcttgaagggaaatgtcaaaatgtgc
gaagagaaatgttctgatgaactcgaagattctactgcttcagatgaaataacaaaatgg
cgtgatgactctgaccatcatgcagtttcggagttgcaacatggtccttttgaacacgat
gatgatgtacttagcatttcttatgggcccttacacctctcatgcagtgttctagttcct
gaatgtattgataaaaattgctttgaggaggcaagagttttgttgcagctggataagaaa
tttattcctgtcatatctggggaagtactactccttgttgatcagcatgcagctgatgaa
aggatacgtttggaggaactccgtcgaaaggttttatcagatgatggcagagggattact
tacttggactctgaggaggacttagttctccctgagactggatttcaattgttccaaaag
tatatgcaacagatccaaagttggggctggatcatcaacagtactaattcctgtgaatca
ttcaaaaagaacatgaacgttctgaggagacaatcgcgccgtcttactcttgctgctgtt
ccatgtattttgggcgtcactttaacaggaaaagatcttatggacttcattcagcagctt
gatgacacagatgggtcgtcagctatccccccagcggtcattcgtattctcaatttcaag
gcttgcagaggtgcgatcatgtttggcgatcctctgctaccatcggagtgctctctgatt
atcgaagaactgaaagcaacatctttatgtttccagtgtgctcatggacgtccgaccacc
gtgccgattgtgaacgtcgcatctctccgcggcgagttggcgaggctcggagcggtgaac
ggaaggcaagaagagacctggcatggtctctcgcaccatggacccagccttgaacgtgct
cgaacgcgcctcagagaactgagaaagctacgtggtggcctgtag

DBGET integrated database retrieval system