KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347791
Entry
4347791           CDS       T01015                                 
Name
(RefSeq) Fanconi anemia group J protein homolog isoform X1
  KO
K15362  fanconi anemia group J protein [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4347791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347791
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4347791
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     4347791
   FA (Fanconi anemia) pathway
    Downstream FA components
     4347791
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 HBB DUF4230 Yippee-Mis18
Other DBs
NCBI-GeneID: 4347791
NCBI-ProteinID: XP_015612512
LinkDB
Position
9:complement(21860320..21877821)
AA seq 1289 aa
MGAATADEDFATPPPPARAPGGRVYQVGGVPVEFPYKPYGTQLAFMGRVIATLDRARRQG
RSHALLESPTGTGKSLSLLCSALAWQRHYPLRAPPAAAPDPFLHGGGFVPDDTQKQATPG
VPEKATRKKNVPTIYYATRTHAQITQVVREYRKTSYRVRMAILASRKHYCVNKNVCMSGN
IDELCKSLLDDSAQGCPEYKNAQKLSRHPSLQIGGCYEVHDIEDLVRVGRKVKGCPYFAA
QTMAEAAQLVFCPYNYLISPIVRRAMDIDIRGSIIVLDEAHNIEDIARDAGSFDVDEESL
LFLRQELEGLVTDEAVAKIYEPLHEVIQGLNGWIDEQGNNLQKNEFEHPASFWTGEEAMK
ELKYAGITPVNFPVLQECATKAIKAASDAESEGVHLSGGSAMTLESLFSSLSYFFAENGR
HSNDYQLALQRFAKREGNSVTSFIGWKCVMSLWCLNPAVVFRDIADLTLSVILTSGTLSP
MGSFASELGVQFEACMEAPHVINADSQVFATVLSSGPTGRRLNASYRTANEYSFQDELGA
TLEEICRVVPGGALVFFPSYNLLEKLQRRWSQTGQWARLEAQKHVCVEPRGSTEELEPVL
KGYYNAILGKAPPKKGRGGAKQIVKNRVTKDSSQESAKGGAAFLAVCRGKVSEGIDFSDD
KARVVVIVGIPFPNINDVQVKLKKRYNDSYKSSKDLLSGNEWYCHQAFRALNQAAGRCIR
HKFDYGGIILIDERYQEERNIVYISKWLRNSIRNCGTFQETMDGLTRFFQNAEEQIKIKA
QGVSPKDRLDACVLPSQGDKRKLPWPEPNFSNQTVLQNNKDVKSESHIDGAGVDRMKLSD
TSSESWHLSSKHSGLVKKQISPEPENVPMACQLPPSYKVQYNLEGEADNGTNYEVNINFI
DLEECDTKPRYVKLTIFNPSEHITQQSTVMEETYAEVPIASPSNRNGENASTVMNEGDPV
LDLPISLSAANRNISCVSTSAATPERSGSISHLEHESWTNRSVNSHCQKRRKLSSPMSCC
TYTERSCSPSKPYLHGGCDVSMLPGDLRTDGMCCKSMKMSRCENVKVERNSKLAEFPSRE
STQEKLFICCARCKTALGLQEDGFLVSCSSSLSSKFYLTYLWRHGPSADILPGKDFLASP
PLKIKVMVCNVSSVNKMMLGNLSNEGSAHNSSFWSEKDGCVYKPVTCQTCSCKNACVTTL
GAQVVATDSSNQQFCDKVILFDDLLHVKHGPSKDQALSAPIGTVKPISPPPVIDLESFAY
KPLKKDPVPVNTRRSKLRLPGTAKSRNGA
NT seq 3870 nt   +upstreamnt  +downstreamnt
atgggcgccgccacggcggacgaagacttcgccaccccgccgccgccggcgcgggcgccc
ggcggcagggtgtaccaggtgggcggcgtgccggtggagttcccgtacaagccgtacggg
acgcagctcgccttcatgggccgcgtcatcgccacgctggaccgcgcgcggcggcagggc
cgctcccacgcgctcctcgagtcgcccaccggcaccggcaagtcgctctccctcctctgc
tccgcgctcgcctggcagcgccactacccgctgcgtgccccgcccgccgccgcccccgac
ccgttcctccacggcggcggcttcgtccccgacgacacccagaagcaggcgacgcccggc
gtcccggagaaggcgaccaggaagaagaatgttccgaccatctactatgcgacgaggacg
cacgcgcagataacccaggtggtccgggagtaccgcaagacgtcataccgagttcgcatg
gccatcttggcctcaaggaagcactactgtgtcaataagaatgtgtgcatgagtggcaac
atcgatgaactatgcaagtcactccttgatgacagtgctcaaggctgtccagaatacaag
aatgcacagaaactaagtcgccatccatcccttcagattggtggctgctatgaagttcat
gatattgaggatctcgttagagttggacggaaagtgaaggggtgcccatattttgctgca
caaactatggctgaggcagctcaactggttttctgcccatataactatctgattagtcca
atcgtgaggagagcaatggacattgacataagaggctcaatcattgttcttgatgaggct
cacaacatagaagacatagcacgtgatgctggaagttttgatgttgatgaagaatcactt
ctctttttgcggcaagaactagaagggttagtcactgatgaggctgttgcaaagatatac
gaacccttgcatgaagttattcaggggcttaatggttggattgatgagcagggaaataac
cttcaaaagaatgagtttgagcatcctgcttcattttggactggtgaagaggctatgaag
gaactcaagtatgctggcattactcctgtaaacttcccagtattgcaagagtgtgcaaca
aaggctattaaagctgcttcagatgctgaatcagaaggagtgcacttaagtggtggttca
gctatgacactagagagtttgttctcctcattgagctacttttttgctgagaatggacgc
cattcaaatgattaccaacttgctttacagcgttttgctaaacgtgaaggcaattctgtc
acttctttcattggatggaagtgtgtgatgagtctgtggtgtctcaatcctgctgttgtt
tttcgagacatcgcagatctaacactttcagtaattctcacatctggcacactctctcca
atgggatcctttgcatctgaacttggtgtccagtttgaagcttgcatggaagctcctcat
gtaatcaatgctgattctcaggtttttgcaactgtgctatcatctggcccaacaggacgt
cgactgaatgccagttatagaactgcaaatgaatattctttccaggatgaacttggagct
acactagaagaaatatgcagagtagtgcctggtggtgctcttgtgttttttcctagctac
aatttgttggagaaacttcaaaggcgctggtctcagacaggtcaatgggcacgattggag
gctcaaaagcatgtatgcgttgagcctagaggaagtaccgaggaacttgagcctgtccta
aaaggatattacaacgcaatccttggcaaggctcccccaaagaaaggcagaggtggtgca
aaacaaattgtgaaaaatcgagtgacaaaggattcatcacaggagtctgctaaaggaggt
gctgcttttcttgcagtttgtcgtggaaaggtatctgaggggattgacttctctgatgac
aaagctagagttgtggttattgttggcattccatttccaaatataaatgacgttcaagta
aagctcaaaaagagatataatgattcatacaaatcatcaaaagatttgttgagtgggaat
gaatggtactgccatcaagcatttcgtgctctgaatcaagctgcaggtcgatgcattcgc
cataaatttgattatggagggataattttgattgatgagcgttatcaggaagaaagaaat
attgtgtatatttctaaatggcttaggaattcaattaggaattgtggtactttccaggag
acaatggatggattgacaaggttttttcaaaatgctgaggaacaaataaaaatcaaagct
caaggtgtgtcccctaaggacagattggatgcttgtgtactcccatctcaaggcgataaa
agaaagctgccatggccagaaccaaatttctcaaaccagacagtactgcaaaataataag
gatgttaagagtgaaagccacattgatggtgcaggagttgaccgtatgaagttgtctgat
acatcatcagagtcatggcatctctcttcaaaacattctggtttagtaaagaaacaaatc
tccccagaaccagaaaatgtgccaatggcatgccaactccctccctcatacaaagttcaa
tataatttagaaggtgaagcagataatgggacaaattatgaagtaaatataaacttcatt
gacttggaagagtgtgatactaagccacggtatgtgaagttaactatctttaatccttca
gaacacataacacaacaatctactgttatggaagaaacttatgcagaggtgccaattgct
agtcccagtaaccgaaatggggaaaacgcctctacagtgatgaatgaaggagatccggtt
ttagatctgcccatttcgctttcagctgctaacagaaacatttcttgtgtgtccacatcg
gcagctactcctgaaagatcaggtagcattagtcatttggagcatgaatcttggactaac
agaagtgtgaattcccactgccagaaaaggagaaagttaagctcccctatgagctgctgt
acctacacagagcgttcatgttctccaagcaaaccctacttacatggtggttgtgatgta
agcatgttgcctggagatctgagaactgatggaatgtgttgcaagagtatgaaaatgtca
agatgtgaaaatgttaaggttgaaagaaacagcaagcttgcagagttcccatcgagggaa
tctacgcaggagaagcttttcatttgttgcgctagatgcaaaacagcacttggattacaa
gaggatggctttcttgtttcatgctcatcgtctttgtcctcaaaattttacttgacatat
ctttggagacatggaccatcagcagatatccttccaggaaaagattttttggcatcacca
cccttgaagataaaagtgatggtgtgcaatgtatcttcagtgaacaagatgatgcttggc
aacttgagcaatgaaggttctgctcataattctagtttttggtctgaaaaggatggatgt
gtgtacaagccagtaacttgtcagacttgctcttgcaaaaacgcctgtgtcacaaccctc
ggagcacaagttgttgcaactgattcgtcaaatcaacaattttgtgataaggtaattttg
tttgatgatcttctgcatgtcaagcatggaccgtcgaaggatcaggctttaagtgctccc
ataggtactgttaaacccatctcacccccgccagtgattgatctcgagtcctttgcgtac
aaaccactgaagaaggatcctgtgccggtgaacacaagaaggtccaagcttaggttacct
ggcacagccaaatccaggaatggtgcataa

DBGET integrated database retrieval system