KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347930
Entry
4347930           CDS       T01015                                 
Name
(RefSeq) type I inositol polyphosphate 5-phosphatase 2 isoform X1
  KO
K24221  type I inositol polyphosphate 5-phosphatase IP5P1/2 [EC:3.1.3.56]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4347930
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     4347930
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 4347930
NCBI-ProteinID: XP_015611629
LinkDB
Position
9:22917073..22919025
AA seq 622 aa
MKLRTGDIFGAVFIACLIALQIMGSQRGKQSEKSFWPLIVMKKWLNIKPKLNDFSEDEFD
TDGGDEDFSDCAEDASDNFFEIHENNHTINRSSGDKIMPLRRLQRRKSESLRVNYISNKD
MRVMIGTWNVAGRAPSEDLDLDQWICSQEPADMYILGFQEVVPLSVGNVLGAEDSRTVPK
WEGIIRRALNKSQQPKANCKSYSAPLSPLRVPIPSDDGHDDTKREYDKMTENLSPQQQCR
DKQTSISKCSCDWLDGTSSLDWPECPLDIPAKISVSNRGLRRVMSMGLFNTDYLENAQGF
DLHGVALQDGIRRSYRSSGNLGMSWSEQQEKVDVLSSVDYMSDWTSDDTTSVVGPDERAT
FAKGESLKPPGNYVRVVSKQMVGIYVSVWVSRKLRQHVNNLEVASVGVGLLGYMGNKGSI
SISMSLFQTRMCFVCSHLASGHKCGDQQKRNSDVDEILQRTRFSSLFAAGQPQKIPSHDQ
IFWFGDLNYRIDMPDAEIRDLVSMKRWDDLLKSDQLTKELTNGNTFAGWKEGLINFPPTY
KYETNSSKYVGEKPDEVGNKRSPAWCDRILWLGKGIKQLSYWSSGLNLSDHRPVSSTFIV
EVEVFNQRKLQRLLNFTNTICS
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaagttaagaactggagatatatttggagctgtgttcattgcctgcctcatagcgttg
cagatcatgggatcccaaagaggaaagcagtcggagaagtcattttggcctttaattgtg
atgaagaaatggctaaacattaagccaaaattaaatgatttcagtgaagatgagtttgat
acagatggaggagatgaggatttcagtgactgcgcagaggatgctagcgacaacttcttt
gagatacatgaaaacaaccacaccattaacagatcatcaggggataaaataatgcctctg
cgaagactacagagaaggaaatcagaaagtttgcgtgttaactacataagtaacaaagat
atgagggtgatgataggaacatggaacgttgctggaagagcccctagtgaagatcttgac
ctagatcagtggatttgttcccaagagccagctgacatgtatattttaggtttccaggaa
gtggtcccattaagcgttgggaatgtcttgggagcagaagatagtagaacagtacctaaa
tgggagggtattatccgccgtgctctcaataagtctcaacaacccaaggcgaattgtaaa
agctacagtgctccactatcaccattgcgagtacctattccttctgacgatggacatgat
gatacaaaacgtgaatatgataaaatgacagaaaatttatctcctcagcaacagtgtaga
gataagcaaacaagtataagtaagtgcagctgtgactggttggatggaactagttcattg
gactggccagaatgcccactagacattccagcaaaaatatcggtatcaaatagagggttg
aggagagtaatgagcatggggctatttaacaccgactatttggagaacgctcaaggattt
gatctacatggtgtagcattgcaagatgggataagacgatcatatcgtagctctgggaat
cttggcatgtcatggtcagaacagcaagagaaggtagatgttcttagttcggttgattat
atgtctgattggacatcagatgacacaacttctgttgttggtcctgatgaaagggcaact
tttgcaaaaggagaatccttaaagcctcctggaaattacgtgcgcgttgttagtaaacag
atggttggtatatatgtttctgtatgggtttcccgtaagctgaggcaacacgttaacaac
ttggaggtagcttcagttggggttggacttctgggctacatgggaaacaagggatcgatt
tccattagcatgtctcttttccaaactcggatgtgctttgtctgctcacatcttgcgtct
ggccataaatgtggggatcaacagaaaaggaactctgatgtggatgagattttacaaaga
acaagattttcttccttgtttgctgctggtcagccacaaaagattccttcacatgatcaa
atattttggtttggagatcttaattatcgtattgacatgccggatgctgaaattcgagat
ttagtatctatgaagagatgggatgatctcttgaagtctgatcagctaacaaaggagttg
accaatgggaatacttttgctggttggaaggaggggttgatcaactttccgcctacttac
aagtatgaaacaaattcaagtaaatatgttggggagaaacctgacgaagtggggaataaa
agatctccagcatggtgtgatcgcatactatggctgggaaagggtatcaagcaactatca
tattggagctcaggtttgaacctctcagatcatcgacctgtcagctccaccttcatcgtt
gaagtcgaggtgttcaatcagagaaaactccaacggcttctgaatttcacaaatactatt
tgctcttaa

DBGET integrated database retrieval system