KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348183
Entry
4348183           CDS       T01015                                 
Name
(RefSeq) maspardin isoform X1
  KO
K19367  maspardin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4348183
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_5 Ammonium_transp Thioesterase
Other DBs
NCBI-GeneID: 4348183
NCBI-ProteinID: XP_015615046
UniProt: Q33AQ0 Q0IYS1
LinkDB
Position
10:4783233..4789929
AA seq 387 aa
MKGGGGAAAASAAPGDYVYFKSVVPLHKISIGPKLWRYYDFGPKTVPPLVCIPGIAGTAD
VYYKQIMSLSMKGYRVMSIDVPQVWNHQEWIHSFEKFLDSMNIHHVHIYGTSLGGFLAQI
FAQHRPRRVKSLVLSNTFLETHKFAAATPWSPVVNWTPSFLLKRYLLTGIRDGPHEPFIA
DSVDFVVSQVETLSRDDLSSRLMLNVNVASVGSLMLPDSLITIMDTNDYSAVPQQLKDQV
NERYPGARRAVLKTGGDFPFLSRPDEVNLYLQLHLRRVGVEPRPDLVQGFTRNGSAGSSK
DQKDGGNNFDNHPGDNGGPGSGGHDHETQNSGSESHDSDESIPTSTMLANTILGTVSSTL
QASLCVLLIHHYYESALYISSRQPLDV
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaagggcggcgggggcgcggcggcggcgtcggcggcgccgggggactacgtctacttc
aagtccgtcgtcccgctccacaagatctcgattggaccgaaattatggaggtactatgat
tttggaccaaagactgttccacctcttgtctgcatcccaggaattgcaggaacggctgat
gtgtactacaaacagatcatgtctctctctatgaagggttatcgagtgatgtcaattgat
gttcctcaagtttggaatcaccaggaatggattcattcatttgaaaaatttttggactcc
atgaatatccatcatgttcatatttatggtacatctcttggtggatttcttgcacaaata
tttgctcaacaccgtccaaggagagtaaagtccttggtcctatcaaatacttttcttgag
acacataagtttgctgctgctacgccatggtctcctgttgttaattggaccccttctttt
ttgctgaagcggtacctattgacaggaatccgagatggcccccatgaaccgtttattgca
gactcagtggattttgttgtgagtcaggttgagacgctgtcaagagatgatctctcatca
aggttgatgttaaatgttaatgttgcatcagttggatcattaatgctacctgattcactc
atcactataatggatacaaacgactattccgctgttcctcagcagttaaaggaccaagtg
aatgaaaggtacccaggtgcaaggcgtgcagtactaaagacgggtggtgatttccccttc
ctgtcacgtcctgatgaggttaatttgtaccttcagctacatttgagacgagttggagta
gaacctagaccagatctggtccaaggtttcacacgtaatggcagtgctgggagctcaaag
gaccaaaaagatggtggaaacaattttgacaatcatcctggagataatggtggccctggt
tcagggggtcatgatcatgagacacagaattctggatcagaatcacatgattctgatgaa
tcaataccaacgagcacaatgcttgccaataccattctaggtacggttagctcaaccctg
caagcttcactatgtgtgctcttgatacatcattactatgagtctgctttgtatatttcg
tcgagacagccattggatgtatga

DBGET integrated database retrieval system