KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348225
Entry
4348225           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIF subunit alpha isoform X1
  KO
K03138  transcription initiation factor TFIIF subunit alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4348225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4348225
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     4348225
SSDB
Motif
Pfam: TFIIF_alpha zf-C3HC4_3 ELL DZR_2
Other DBs
NCBI-GeneID: 4348225
NCBI-ProteinID: XP_015614802
UniProt: Q7G4R3 Q8LMN8
LinkDB
Position
10:complement(6080043..6087849)
AA seq 532 aa
MGSADLVLKAACEGCGSPSDLYGTSCKHTTLCSSCGKSMALSGARCLVCSAPITNLIREY
NVRANATTDKSFSIGRFVTGLPPFSKKKSAENKWSLHKEGLQGRQIPENMREKYNRKPWI
LEDETGQYQYQGQMEGSQSSTATYYLLMMHGKEFHAYPAGSWYNFSKIAQYKQLTLEEAE
EKMNKRKTSATGYERWMMKAATNGPAAFGSDVKKLEPTNGTEKENARPKKGKNNEEGNNS
DKGEEDEEEEAARKNRLALNKKSMDDDEEGGKDLDFDLDDEIEKGDDWEHEETFTDDDEA
VDIDPEERADLAPEIPAPPEIKQDDEENEEEGGLSKSGKELKKLLGKAAGLNESDADEDD
EDDDQEDESSPVLAPKQKDQPKDEPVDNSPAKPTPSGHARGTPPASKSKQKRKSGGGDDS
KASGGAASKKAKVESDTKPSVAKDETPSSSKPASKATAASKTSANVSPVTEDEIRTVLLA
VAPVTTQDLVSRFKSRLRGPEDKNAFAEILKKISKIQKTNGHNYVVLRDDKK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggggagcgccgacctggtgctgaaggcggcgtgcgagggctgcggctcgccgtcggac
ctctacggcacgtcgtgcaagcacaccacgctctgcagctcctgcggcaaatccatggcg
ctctccggcgcccgctgcctcgtctgctcggcccccatcaccaacctcatcagggaatat
aatgtacgggccaatgccaccacagataagagcttctctattggaagatttgtgactggt
ttaccccctttctcaaaaaagaagagtgcggaaaacaaatggtctcttcataaggagggg
ttacaaggtcgccagattcctgagaatatgcgggaaaaatacaataggaagccatggatt
ttggaagatgaaactgggcaatatcagtatcaaggtcaaatggagggatcacagtcatca
acagctacatactatttgttgatgatgcatggcaaggaatttcatgcatatcctgctggt
tcttggtataacttcagtaaaattgcacagtacaaacaacttaccctggaagaggctgaa
gagaagatgaataagagaaaaactagtgcaactggttatgaacgttggatgatgaaagca
gctacaaatgggccggctgcctttggttcagacgtaaagaaacttgagcctacaaatggc
actgaaaaagaaaatgcccgccccaagaaagggaaaaataatgaagagggtaacaattct
gataaaggcgaggaggatgaagaagaggaagctgcacgcaaaaataggcttgcgctcaac
aaaaaaagtatggatgacgatgaggaaggtggaaaggatctggacttcgatttggatgat
gaaattgaaaaaggtgatgactgggagcacgaagaaacattcactgacgacgatgaggct
gtggatatagacccagaggagcgggcagatttagctcctgagattcccgctcctcctgaa
attaagcaggatgatgaagagaatgaagaagagggtggtctgagcaagtctggcaaggag
ttgaaaaagcttcttgggaaagctgctggacttaatgagtcagatgccgatgaggatgac
gaagatgatgaccaggaggatgagtcatctccagtgcttgctccaaaacagaaggatcaa
cccaaagatgaacctgtagataacagccccgctaaaccaacaccatcaggacatgctcgt
ggcacacctcctgcatccaaatcgaagcaaaagaggaaatcaggtggtggtgatgattca
aaagcatctggcggtgcagcttccaaaaaagcaaaggtggaatctgatacaaaaccatca
gtggccaaagatgagacaccatcttcctcaaaacctgcatcgaaggccactgctgcatca
aaaactagtgcaaatgtatctcctgtcacagaggatgaaatcaggactgttcttcttgct
gttgctcctgtcactacacaagatttggtatctagatttaagtctagactacgaggtcca
gaggacaagaatgcttttgctgaaattctgaagaaaatatcgaagattcagaagactaat
ggccacaattatgtcgtccttagagatgacaagaagtga

DBGET integrated database retrieval system