KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348755
Entry
4348755           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 4
  KO
K10576  ubiquitin-conjugating enzyme E2 H [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4348755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4348755
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4348755
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4348755
SSDB
Motif
Pfam: UQ_con UEV Prok-E2_E
Other DBs
NCBI-GeneID: 4348755
NCBI-ProteinID: XP_015614603
UniProt: Q337R4 A0A8J8XMC8
LinkDB
Position
10:16180803..16184980
AA seq 183 aa
MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP
YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVTPEDKSSDEELSEDEDDSGDDAILGN
PDP
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcttccccgagcaagcgccgcgagatggacttgatgaagctgatgatgagcgactac
aaggtggagatggtgaacgatgggatgcaggagttcttcgtggaattccgggggcctact
gaaagtatttatcaaggtggtgtctggaaggttagagtagaattgcctgatgcatatcct
tacaaatctccgtcgattggtttcgttaacaagatttatcatcctaatgtggatgaaatg
tctggttctgtgtgtttggatgtcattaaccagacgtggagcccaatgtttgatctagtt
aatgtgttcgaagtcttccttccacaacttctattgtacccaaatccttctgacccatta
aatggagaggctgctgcactgatgatgcgtgatcgtcctgcttatgaacaaaaagtgaaa
gaatattgcgaaaaatatgcaaagcccgaggatgctggcgtaacccccgaagataagtcg
agtgatgaagaacttagtgaagatgaagatgactccggggatgatgctatactcggcaac
ccagatccttag

DBGET integrated database retrieval system