KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348849
Entry
4348849           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis protein 12
  KO
K13345  peroxin-12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4348849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4348849
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    4348849
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 zf-C3HC4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 4348849
NCBI-ProteinID: XP_015612896
UniProt: A0A8J8Y1N5 Q337M1
LinkDB
Position
10:17250735..17255665
AA seq 394 aa
MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSLGVFALRRPLLHKVLDYEDEFFALLM
AVLESHSLRTTDGSFSESLYGLRRRPVKVSVKRSSSGAESNDKAYDSVLRKRQKVLSVVF
LVVLPYFKSKLQSIYNKEREARLQASLWGQGDVRFDEADLVSDQGETSQAQVEATTGEVS
NMARIKKNFAALIGVCYPWIHATNEGLSFAYQLLYLLDGTAFYSPALHALGLHVCRATGQ
ELMESSSRVSRIRNRELERLRGPPWLKTMQRVLLNCMYTSLDYAQTGLIAAVFFFKMMEW
WYQSAEERMSAPTVYPPPPPPPLPKVAKDGLPLPPDRTLCPLCCQKRNNPSVLSASGFVF
CYSCIFKSVSQHKRCPITLMPATVEQIRRLFHDL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgttccaggtgggagggcagggggcgcggcccaccttcttcgagatgtcggccgcg
cagcagctgccggccagcctccgcgccgcgctctcctactcgctcggggtttttgcacta
agacggccgttgttacataaagttttagattacgaggatgaattctttgccttgttaatg
gctgtccttgagtcccatagtttgcgaacgacagatggttctttttcggagtcattgtat
ggtctcaggcggagacctgttaaggtttcagtaaagagaagtagttctggtgcagaatcc
aatgataaagcctatgattctgttctaaggaagcgccagaaagtcctttctgttgttttt
ttggttgttttgccatatttcaagtcaaagctgcagtccatatataacaaagaaagggag
gccaggttgcaggcaagcctttggggtcagggtgatgttagattcgatgaagctgacctt
gtttcagatcaaggggagacttctcaagcacaagtcgaggctacaactggagaagtatca
aatatggcacgtattaagaagaattttgcggcattaataggtgtttgctatccatggatt
catgcgaccaatgaaggtctctcatttgcttaccagttgctgtatttgttggatggtact
gcattttatagtccagcactgcatgctcttgggcttcatgtttgtcgtgctacaggacaa
gagctgatggaatcatcttctagggtatcaagaatcagaaatcgagaacttgagagactt
cgtggtcctccatggctgaagaccatgcaaagggtgttacttaactgtatgtacactagc
ctagattatgcacaaactggtttgattgctgcagttttctttttcaagatgatggaatgg
tggtatcaatctgctgaggaaagaatgtcagctccgactgtatatcccccaccccctcct
ccacctctgccaaaggttgctaaagatggacttcccttgccccctgacaggacattgtgc
cccttatgctgccagaagcgcaataacccttctgttctttctgcttctggttttgtattc
tgctacagttgcatttttaagtcagtctcccagcataaaaggtgccccatcacattgatg
cctgccacagtagaacaaatcagacgcctctttcatgatttgtag

DBGET integrated database retrieval system