KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348870
Entry
4348870           CDS       T01015                                 
Name
(RefSeq) cyanate hydratase
  KO
K01725  cyanate lyase [EC:4.2.1.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4348870
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.104  cyanase
     4348870
SSDB
Motif
Pfam: Cyanate_lyase DUF2805
Other DBs
NCBI-GeneID: 4348870
NCBI-ProteinID: XP_015614137
UniProt: Q9FWK4
LinkDB
Position
10:17471604..17474840
AA seq 168 aa
MEGGGGERAAGVVRRLMAAKAESRKSFSEIGEEAGLTNVYVAQLLRRQAQLKPETAPALR
AAVPGLTDDLVALMMEPPFRSYHPDIVHEPAIYRLNEAVMHFGESIKEIINEEFGDGIMS
AIDFYCSVDKVQGADGKDRVVVTFDGKYLPYSEQRSDHMMSRLTRKTS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagggcggcggcggggagagggcggcgggggtggtgcggcggctgatggcggcgaag
gcggagtcgcggaagagcttctcggagatcggggaggaggcggggctgaccaacgtgtac
gtggcgcagctgctgcggcggcaggcgcagctgaagccggagacggcgccggcgctgcgg
gcggccgtgccggggctcaccgacgacctcgtcgcgctcatgatggagccgccgttccgc
tcctaccacccggacatcgtccacgagcccgccatctacagattgaatgaagctgttatg
cattttggagagagcatcaaggaaattatcaatgaggagtttggtgatggaatcatgtca
gctatagacttctactgttcggttgacaaggtacaaggtgctgatggaaaagatcgcgtg
gtggtcacatttgatgggaaatatcttccttacagtgagcagagatctgatcatatgatg
tctaggctgacccgcaagacatcttga

DBGET integrated database retrieval system