KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348939
Entry
4348939           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-processing protein 40C isoform X1
  KO
K12824  transcription elongation regulator 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4348939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4348939
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4348939
 Complex B
    4348939
SSDB
Motif
Pfam: FF WW RhoGAP-FF1
Other DBs
NCBI-GeneID: 4348939
NCBI-ProteinID: XP_015614639
UniProt: Q337J6 Q0IWV8
LinkDB
Position
10:complement(18321126..18331776)
AA seq 1078 aa
MATPATAASDATNPEAAEVPSAAPASESEGPFDSGVVAAATTPAVVDSAVEGDAPAAPAP
TSGSGPAAPSMPANPASPATPGPPRPQFAGSPAYASPPAPAFSYNVLPRPSPRPQVGSGA
AQQQLASPPAMMAPSVAAAALQPPVPGQYFGNRPSFSYNVVSHANAGLPTGQQFQLDTGT
NHAVQVSRFVPPSSLQPPAPMNLARPSSAFPGAGAMPPNPPGSIRLPFPGPPRPSINTFV
ASPQQAQPQASQLPSNSGSSDVSTSRSDTRSVPEASPQTMQLSTGPPSTSTAGSPSITVQ
MPTNPSLPTRPEVFGAIGASVPGQPSTILSAPPSLLGRPMTPSASPFPQTSQSPTAFQQP
GQQQLYPSYPSAHGVQPQPLWGYPPQPTGFQQPPFQSYPSGLLGPLGRPMVGSSSVTAYL
PSIQPPGVSTTDRDSKELSSANPGSEQPTQQGSQNSDQLEDKRTTAIQDSDSWSAHKTEA
GVVYYYNALTGESTYQKPPGYKGEPEKVAAQPVPVSWDKLAGTDWSIVTTSDGKKYYYDN
KLKVSSWQLPPEVAELIKNAESGPLKGSSTSLQDAGTIGNKEEISIDIDTPAVQTGGRDS
LPLRQTVAPASSSALDLIKKKLQDAGASSVPSPLATPSSASELNGSKTTDAAPMGHQVSI
SGEKSKDNSGDGNMSDSSSNSDDEEHGPSEEECTRQFKEMLKERGVLPFSKWEKELPKIV
FDPRFKAIPSHSRRRSTFEQYVRTRADEERKEKRAAQRAAVEAYKQLLEEASEDINSNKD
YKEFKRKWGTDPRFEALDRKERDALFNEKVKSIEEKVQSVRNAVIAEFKSMLRESKDITS
TSRWTKVKENFRSDARYKAMKHEEREVAFNEYIAELKSAEKEAEQAAKAKLDEQAKLKER
EREMRKRKEREEQEMERVKLKIRRKEAVSSYQALLVEIIKDPKASWTESKPRLEKDPQGR
AVNPDLGKGDAEKLFRDHVKDLYERCVRDFRALLSEVITPEIAARTTDEGKTAINSWTEA
KGLLRSDPRYNKLASKDRESIWRRYADDMKTKLKQSDMKERSDTDGKQRRSSDPPRRR
NT seq 3237 nt   +upstreamnt  +downstreamnt
atggcgacgccggcgacggccgcctccgacgcgaccaacccggaggcggcggaagtgccg
tccgctgccccggcgtcggaatcggaaggaccgttcgattccggcgtcgtcgcggcggca
acgacaccggcggtggtggatagtgcggtggagggagacgccccggccgctcccgctcct
acctccggctccggtcctgcggcgccgtctatgccggcgaatccggcgtctcctgcaact
ccagggcccccgcggccgcagttcgccgggtcgcccgcttacgcgagccccccggcgccg
gcgttctcgtacaacgttcttccgaggccgtcaccccggccgcaggtgggcagtggtgcg
gcccagcagcagctagcttcccctccggccatgatggctccttcagtggctgctgcagct
cttcagcctcctgtcccagggcaatattttgggaacaggccgtctttttcatataatgta
gtctcgcatgctaatgctggcttgcctactggtcagcagtttcaacttgacaccggcaca
aaccatgctgtccaagtttcacggtttgttccaccatcatccttgcaacctccagctcct
atgaatttagctcgcccaagttcagcatttccaggagcaggagctatgccaccaaatcct
cctggatctattcgcttgccatttccaggtccacccagaccatccatcaatacttttgtt
gcaagcccacaacaggcacagccccaggcatctcagttaccttcaaacagtgggagctca
gatgttagcacttccaggtctgatactcgaagtgtcccagaggctagtccccagaccatg
cagttgtcgacaggcccaccatcaacaagtactgctggaagtccttcaatcactgttcag
atgccaacaaatccatcacttccaactcgcccggaggtttttggggccattggtgcttct
gtacctggacaaccttccacaatcttgtctgctccaccaagcctccttgggagacctatg
actccatctgcttctccttttccccaaacatcgcagtctccaactgcttttcaacagcct
ggtcagcaacagttgtacccctcctatccttcagcacatggggttcaacctcagcctcta
tggggatatcccccacagcctactggttttcagcaaccccccttccaatcatacccatct
ggtcttctagggcctcttggtaggccgatggttgggagttcttctgtgactgcatacttg
ccaagcatacaaccacccggtgtctcaacaactgacagggattccaaggagctatcatca
gcaaatcctggatctgagcagcccactcaacagggaagccaaaacagcgatcagctcgag
gacaaaagaactactgccattcaggattcagattcatggtctgcacacaagacagaggct
ggtgttgtatattattacaatgccttgactggagaatcaacttatcaaaaaccacctggt
tataaaggggagcctgagaaggtcgcagcccagccagttccagtttcttgggacaaactg
gctggcactgactggagcatagtaacgacaagtgatggaaagaaatattactatgataat
aagctaaaggttagcagctggcagcttccaccagaggtggctgagctcatcaagaatgcc
gagtctggtccattgaaaggaagttcaacttcgctgcaagatgctggcacgatagggaat
aaagaggaaataagtattgatattgatactcctgctgtacagacaggtggccgtgattcg
ttgccacttcgacaaacagttgcccctgcatcgtcttctgctttggatttaataaagaag
aaattgcaggatgctggcgcttccagtgtgccttcacctcttgctactccatctagtgca
tccgagctgaatgggtctaaaacaactgatgctgcacctatgggacatcaagtctcaatt
agcggcgagaaatcaaaagataacagtggtgatggtaatatgtcagattcctcttcaaat
tcagatgatgaggaacatggcccaagtgaagaggagtgtactcgtcagtttaaggagatg
ttaaaggaaagaggtgtattgccattttcaaagtgggaaaaggaactcccaaaaatagtg
tttgatccacgttttaaggctattccaagtcactcgaggagacggtctacatttgagcag
tatgttcggacacgtgctgacgaggagcggaaagagaaaagagctgctcagagagctgca
gtggaggcgtataaacagttactagaagaagcatccgaggacatcaactccaataaggat
tacaaggaattcaaaagaaaatggggcactgatccaaggtttgaagccttggaccgaaaa
gaaagggatgctcttttcaacgagaaggtgaaatcgattgaagagaaagttcaatcagtg
cgcaatgctgtgatagctgagttcaaatcaatgcttcgagaaagtaaagacataacctct
actagccgttggaccaaagtgaaagaaaatttccggagcgatgcaaggtacaaagccatg
aagcacgaagaaagagaggttgcttttaatgagtacatagcagaactaaaatccgctgaa
aaggaagcagagcaagctgccaaggccaaactggatgaacaagccaagttaaaggagagg
gagcgcgagatgcggaaaaggaaagaaagggaagaacaggaaatggagagagtaaaattg
aagatccgaagaaaagaggccgtgtcttcatatcaagctttacttgttgaaatcataaaa
gatcccaaggcatcatggacagaatccaaaccaagacttgaaaaggatccacaaggccgt
gcagtaaatcctgatttaggtaaaggtgatgcagaaaagttatttcgtgaccatgtcaag
gacctgtatgagcgatgtgttcgggatttccgtgcgctcctatctgaggtgataactcca
gagatagctgctcgaacaacagatgaaggaaagactgcaattaactcctggaccgaagca
aaaggtcttctaagatctgatcctaggtacaacaaactggcaagtaaagaccgggagtct
atttggcggcgctatgcggacgacatgaagacaaaacttaaacagtcagatatgaaggag
agatcagatacagatggaaagcagcgtaggtcctctgatccgccaaggcggagatag

DBGET integrated database retrieval system