KEGG   Oryza sativa japonica (Japanese rice): 4348951
Entry
4348951           CDS       T01015                                 
Symbol
NBS1, OsJ_31956, OsNbs1
Name
(RefSeq) nibrin homolog
  KO
K10867  nibrin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4348951 (NBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4348951 (NBS1)
   03400 DNA repair and recombination proteins [BR:osa03400]
    4348951 (NBS1)
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    4348951 (NBS1)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     4348951 (NBS1)
    BRCA1-C complex
     4348951 (NBS1)
SSDB
Motif
Pfam: FHA BRCT Nbs1_C YNCE Yop-YscD_cpl
Other DBs
NCBI-GeneID: 4348951
NCBI-ProteinID: NP_001409998
LinkDB
Position
10:join(19103027..19103063,19103163..19103216,19103600..19103858,19104068..19104156,19104317..19104447,19104572..19104618,19104701..19104809,19104889..19104975,19105193..19105364,19105509..19105981,19106074..19106135,19106209..19106311,19106398..19106457)
AA seq 560 aa
MVWALTPVDTVRGAQRCYIFAAGTYKVGRKDCDVIVQTDTSISRVHAEIVVEKMVAWDPQ
SGAPANPSYVRVVDRSKYGTFFNKVQGTQGSRLHKDEDAMLADGDTVTFGTGNATFRLSF
VPIVVFFHGKKSGRISPCLQAVMTSIGAYATRKWSDECTHVLVDESCSLTPELLDAVLAK
KQIVLGDWFKVMAEKNIHTEMPSSTQYIPKLTLDGMEIQVVEIKLIESCLAGYTFILGSS
EKYKFGDKLHALLESTGAKYLHVDEFCANSQDSGAGENDKDILLVPAKSPLEFSKIRGLF
PLSKITDVKLFAAILSGHLEATAIEPPAYIVASSNSTDETIVVDSDVEIDTATSDHTVAA
SKSEHHIEHISDDKKEVVAISEEDAVNLVEAKTSINLHSDQEKDEIVKPMEEDVKVIEKT
ATMRGFKVEGEDIPVMTKVPKDETLDSRDETCHVIYTQNLVVKSILQSARAESIETGGIN
FKRFRKRGAVSGNSFKDLIPYSREPYRESDYERGTVTDFMREEKKRRQMEAIAEDLFNNA
KPKKKAAAGSSIHTMLTGRR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggtgtgggcgctgacccccgtcgacacagtgcgcggggcgcagaggtgctacatcttc
gccgccgggacgtacaaggtcggccgcaaagattgcgatgtcattgttcaaacggacaca
tcgatatcgcgagtccatgcagagattgtggttgaaaagatggtggcctgggatccacaa
tctggcgcaccagctaacccttcctatgtccgtgtagttgaccgctcaaagtatgggaca
tttttcaacaaggtacagggaacacagggtagtcgccttcataaagatgaagatgcaatg
cttgctgatggggatactgtaacttttggaactggcaatgcaaccttcaggttgtcattt
gtccccatagtagtcttttttcatggaaaaaagtcagggaggattagtccatgtttgcag
gcagtaatgacatccattggtgcatatgctactcggaagtggagtgatgaatgcactcat
gtccttgttgacgagtcatgttcattgacacctgagctcctagatgcggttttggcgaaa
aagcagatcgtcctgggagactggtttaaggtgatggctgaaaagaacatacacaccgaa
atgccttcttctacacagtatattccaaagttgacccttgatgggatggagatacaggtg
gtggagatcaagctcatagagagctgccttgcaggctatacttttatcttggggtcatca
gaaaagtataaatttggagacaaactacatgctttactggaatctactggagcaaaatat
ctgcacgttgatgagttttgtgcaaacagccaggactctggagctggtgaaaatgataaa
gatattcttcttgttcctgcaaaatctcctttggaattcagtaagatacgcgggctattt
cctttgtccaagatcaccgatgtaaagctctttgctgctattttatctggtcacttagaa
gcaactgccattgaaccgccagcttacattgttgcatcctcaaattcgacggatgagact
attgtggtggactctgatgtagaaattgatactgcaacttctgatcatactgttgctgct
agcaagtctgaacatcacattgagcatatttctgatgataaaaaggaagtcgttgctata
tctgaagaagatgctgtaaatttggtggaagcaaagaccagcattaatcttcacagtgac
caggagaaagatgagattgtgaaacctatggaggaggatgtcaaggtcatagagaaaaca
gcaacaatgcgtggtttcaaagttgaaggcgaggacattcctgttatgaccaaggtgcca
aaggatgaaactttggacagcagagatgagacttgtcatgttatatatacccagaatctg
gttgtgaaaagcatccttcagtcagctcgtgccgaatccatagaaactggtggcattaac
ttcaaacgctttagaaagagaggagcagtgtctggaaacagcttcaaggacctaatcccg
tattcacgagaaccatacagagaatctgattacgagcgtggaacggtaactgacttcatg
cgagaggagaagaagcggaggcaaatggaagccattgcagaggacctcttcaacaatgca
aagccaaagaagaaggcagctgctggtagttcgattcacaccatgcttaccggccgcaga
tga

DBGET integrated database retrieval system