KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349123
Entry
4349123           CDS       T01015                                 
Name
(RefSeq) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4349123
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4349123
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     4349123
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Met_gamma_lyase
Other DBs
NCBI-GeneID: 4349123
NCBI-ProteinID: XP_015614439
UniProt: B9G6M2 Q7XCS3
LinkDB
Position
10:complement(20001166..20004618)
AA seq 464 aa
MAHVMAASELVTATIKRPFQNDDDNSSNGNGNADGKPKARRREADPAAALAAARHEFGEH
GGVNMSIEASATFTVMEPDTMRRLFSGELGPERGDLYIYSRHFNPTVLALGRQMAALEGT
EAAYCTASGMSAISSVLMQLVGAGGHVVASRCLYGGTHALLSRFLPRASGVRATFVDADD
EAAVRAAVRPGETRVVYVETMSNPTLAVADIPMLARVAHDAGAKLVVDNTFTPMVVSPAR
LGADVVVHSVSKFISGGADIIAGAICGPASLVNAMMDLQEGALMLLGPTMNAKVAFELSE
RLPHLPLRMQEHSRRAAEYASRMRRLGLRVAYPGLPDHPHHARLLAIANPGYGAGGMLCV
DMGTEDRANRLMHHLQNTTRFGLMAVSLGYYETLMSCSGSSTSSEMPPEDRARAGISPGL
VRMSVGYNGTLEQRWAQFERALSLMQQQQQQHPDRDAAAKYCKV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcccacgtcatggccgcctccgagctcgtcaccgccaccatcaagcgccccttccag
aacgacgacgacaacagcagcaacggcaacggcaacgccgacgggaagcccaaggcgcgg
cgccgggaggccgacccggcggcggcgctggccgcggcgcgccacgagttcggcgagcac
ggcggggtgaacatgtccatcgaggcgtcggcgacgttcacggtgatggagccggacacc
atgcgccgcctcttctccggggagctcggcccggagcgcggcgacctgtacatctacagc
cgccacttcaacccgacggtgctggcgctggggcggcagatggcggcgctggagggcacc
gaggccgcgtactgcacggcgtccgggatgtccgccatctcctccgtgctgatgcagctc
gtcggcgcgggggggcacgtggtggcgtcgcggtgcctgtacggcggcacgcacgcgctg
ctgtcccggttcctgccgcgcgcgtccggggtgcgcgcaacgttcgtggacgctgacgac
gaggcggcggtgcgcgccgcggtgcgcccgggggagacgcgggtggtgtacgtggagacg
atgtcgaacccgacgctggccgtggccgacatcccgatgctggcccgcgtcgcgcacgac
gccggcgccaagctggtggtggacaacacgttcacgcccatggtcgtctcgccggcccgc
ctcggcgccgacgtcgtcgtccacagcgtctccaagttcatcagcggcggcgccgacatc
atcgcaggggcgatctgtgggccggcgagcctggtgaacgcgatgatggacctgcaggag
ggggccctgatgctgctgggcccgacgatgaacgccaaggtggccttcgagctctcggag
cgcctcccgcacctcccgctccggatgcaggagcactcgcggcgcgccgccgagtacgcg
tcccggatgcgccgcctcggcctccgcgtcgcctacccgggcctccccgaccacccgcac
cacgcccgcctcctcgccatcgccaacccgggctacggcgccggcggcatgctctgcgtc
gacatgggcaccgaggaccgcgccaaccgcctcatgcaccacctccagaacaccacccgc
ttcggcctcatggccgtcagcctcggctactacgagaccctcatgtcgtgctccggcagc
agcaccagcagcgagatgccgcccgaggaccgcgctcgcgccggcatctcccccggcctc
gtccgcatgtccgtcgggtacaacggcacgctcgagcagcggtgggcgcagttcgagcgc
gcgctctcgctcatgcagcagcagcagcagcagcatcccgaccgcgacgccgccgccaag
tactgcaaggtgtga

DBGET integrated database retrieval system