KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349131
Entry
4349131           CDS       T01015                                 
Name
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4349131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349131
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4349131
SSDB
Motif
Pfam: Rad10 HHH_2 HHH_5 HHH HRDC DUF1178 UPF0758_N
Other DBs
NCBI-GeneID: 4349131
NCBI-ProteinID: XP_015612964
UniProt: Q337B1 Q0IWC4
LinkDB
Position
10:complement(20070729..20074319)
AA seq 387 aa
MDGQWEEPQHAGRRRRQPEPGKNLIKIPSYQEVFGSGASSSAAPPSYNPPPTTAASSSSS
SSSFSQAFSFLKSTEFYSPPPPPPQTTTPRPPQASSAAQAPKNAILVSHRQKGNPLLKHI
RNARWTYADIVPDYVLGQSSCALYISLRYHLLHPDYLYYRIRELQKNFKLRVILCHIDVE
DVVKPLHEVTRTSLLHDCTLLCGWSLEECGRYLETIKVYENKSADSIREHMDNDYLSRLT
HALTSIRHVNKTDVVTLGSSFGSLSQVMNASMEELARCPGIGERKVKRLHDTFHEPFKRV
SSRPNIVVPDTPDREKASGQPSSTNDGAQDAVEKPDASVNKKSSNVRSALTEAFAKYSEK
IRNQNRDSTNVAGEGTSKSTMGDEKDQ
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggatgggcagtgggaggagccgcagcacgcggggcggcggcggcggcagccggagccc
gggaagaacctcatcaagatcccttcctaccaggaggtgttcgggagtggcgcctcatcc
tccgccgcgccgccctcctacaaccctccacccaccaccgccgcctcctcctcctcctcc
tcgtcgtcgttttcgcaggccttctccttcctcaaatccaccgagttctactccccgcca
ccgccgccaccacagacgaccaccccaagaccgcctcaggctagctcagctgctcaggcg
ccaaagaacgccattcttgtgagccataggcagaaagggaatcccttactgaagcacatc
aggaacgcgaggtggacgtacgccgatatagtgccggactacgtgctcgggcaatcgtca
tgcgcactgtacataagtctccggtaccatcttctacaccctgactacttgtattatcgg
ataagagagttgcagaagaatttcaagctccgcgtcattttgtgccatattgatgttgaa
gatgtcgtcaaacctttacatgaagttacaagaacatcactgctacatgactgcaccctc
ttgtgtggatggagcctggaggagtgtggtcggtacttggagaccattaaagtgtacgaa
aacaagtcagctgacagcattcgtgaacatatggataatgactatttatcaaggttgacg
catgctcttacatccattcggcatgttaacaagacagatgttgtgacgcttggctcatct
tttgggtcactttcacaagttatgaatgcttctatggaagaactagctcgatgcccagga
attggtgagcggaaggtaaaacgacttcatgacactttccacgagccattcaaacgggtt
tccagccgcccaaacattgtagtgcctgacactcctgacagagagaaggcgtcaggccaa
ccttcatcgacaaatgatggtgcacaggatgctgtggagaagccagacgcatccgtgaac
aagaagagttctaatgtaagatcagcccttactgaagcctttgccaagtattcagaaaag
atacgcaaccagaatcgtgattcaacaaatgtggctggtgaaggtactagcaagtcaact
atgggagatgaaaaagaccaataa

DBGET integrated database retrieval system