KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349141
Entry
4349141           CDS       T01015                                 
Name
(RefSeq) probable trehalase
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4349141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4349141
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     4349141
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4349141
SSDB
Motif
Pfam: Trehalase
Other DBs
NCBI-GeneID: 4349141
NCBI-ProteinID: XP_015612974
LinkDB
Position
10:complement(20154545..20159458)
AA seq 592 aa
MPPRPPRPHKLLVFLVLFLFSVPLLRPIHMAPTAAVAGGGVEAEALLGLLQRVQSEALRA
FGPNDFDPKLYVDLPLAADASAAAALASLPRAAPSRGEMEAYISRYFALAGSDLVAAADP
PDFERDPPGFLPRVERAEARAWALEVHALWKDLTRRVAPAVAARPDRHTLLPLPGRVVVP
GSRFREVYYWDSYWVVRGLLVSKMYETAKDIVLNLVYLVEKYGFVLNGARSYYTNRSQPP
LLSSMVLDIYMATGDMAFVRRVFPSLLKEHSFWMSEVHNVAVMDNHGRVHNLSRYQAMWN
KPRPESATIDEEFASKLSTAAKEKFYHQVASTAETGWDFSSRWMRDSTDMTTLTTSCIIP
VDLNTFILKMEQDIAFFAKLIGESTTSEIFSEASKARHNAIDSVLWNADMEQWLDYWLPT
DGNCQGVYQWKSISQNRAIFASNFVPLWLNAQHSGLEQFVDEAKSVRVMRSLQKSGLLQP
AGIATSLSNTGQQWDFPNGWAPLQHLIVEGLLRSGSGEARELAEDIATRWVRTNYDAYKA
TGAMHEKYDVVTCGKSGGGGEYKPQTGFGWSNGVILSFLDEFGWPQDKKIDC
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgccgcctcggcctcctcgtcctcacaaacttctcgttttcctcgtactcttcctcttt
tctgtccccttactccggccgattcacatggcgcccaccgccgcggttgccgggggtggc
gtggaggcggaggcgctgctggggctgctgcagcgggtgcagtcggaggcgctgcgggcg
ttcgggccgaacgacttcgaccccaagctctacgtcgacctgccgctcgccgccgacgcc
agcgcggcggccgcgctggcgtcgctgccgcgggcggcgccgtcgaggggcgagatggag
gcctacatctcgaggtacttcgcgctggccgggtccgacctcgtcgccgccgccgacccg
ccggacttcgagcgcgacccccccgggttcctgcccagggtggagcgcgccgaggcgcgg
gcctgggcgctggaggtgcacgcgctgtggaaggacctgacgcggcgggtggcgccggcc
gtcgcggcgcgccccgaccggcacacgctgctgccgctccccggcagggtggtcgtgccg
ggctccaggttccgggaggtctactactgggactcctactgggtcgtcagaggtttactg
gtgagcaaaatgtatgagacggcaaaggatatcgtgcttaatcttgtgtatcttgttgag
aaatatggttttgttctgaacggggcaagatcgtactacactaaccgaagccagccacca
cttttaagctccatggttttagacatatacatggcaactggtgatatggcttttgtgagg
agggtatttccctcactgctgaaagagcatagtttctggatgtcagaggttcacaatgtg
gcagtaatggacaatcatggacgggtacataatttgagtcgctaccaggctatgtggaac
aaacctaggccagaaagtgcaacaattgatgaggaatttgcttcaaaactttctacggct
gctaaagaaaaattctaccaccaagttgcttctacagctgaaacaggatgggattttagc
tctcgatggatgagggattctactgacatgacaactctgacaacatcttgcataatacct
gtggacttgaacacattcatattgaagatggaacaggacatagctttctttgctaaactc
attggagagagcacaacatcagaaatattttcagaggcttcaaaagcacgccataatgca
attgattctgttctgtggaacgctgacatggagcaatggcttgactactggcttcctact
gatggaaactgccagggagtctaccaatggaaatctatctcacagaaccgcgccatcttt
gcttctaattttgtacctttgtggttaaatgctcaacattcaggcttggagcaatttgtc
gatgaggcaaaatcagtgagagtcatgagaagcctccagaaatcaggattactgcaacct
gcaggaatcgcaacttccttatcaaacacagggcaacaatgggattttccaaacggatgg
gccccgttgcagcatctgatagtcgagggattgttgaggtctggttcaggagaggcaagg
gaacttgctgaggacattgccacgaggtgggtgagaacaaactatgatgcctataaggct
accggcgcgatgcatgagaagtacgatgtggtgacctgtggaaaatctggaggtgggggt
gaatacaaaccccagactggttttggttggtccaacggtgtgatattatcattcttggat
gaatttggatggcctcaggacaagaagatagactgctag

DBGET integrated database retrieval system