KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349298
Entry
4349298           CDS       T01015                                 
Name
(RefSeq) tetratricopeptide repeat protein SKI3
  KO
K12600  superkiller protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4349298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349298
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     4349298
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_16 TPR_8 TPR_17 TPR_14 TPR_12 TPR_7 TPR_9 NatA_aux_su BTAD
Other DBs
NCBI-GeneID: 4349298
NCBI-ProteinID: XP_015614539
LinkDB
Position
10:complement(21444267..21453623)
AA seq 1423 aa
MPEKAAEANLRKQLEQTLAGEPSSPLHHYNLGVFLWDRAEAAAREEGEEEEEVRRLRAAA
AERFLAAAKLDPNDGVPFRFLGHHYALAGDAQRAAKCYQRAATLNPDDAEAGEAVCDLLD
LEGKESLEIALCKEAAGKSPRAFWAFRRLGYLQVHQKKWSEAIQSLQYAIRGYPTCADLW
EALGLAYHRLGMFTAAVKSYGRAVELDGSKVFALIESGNIQLMLGYFRKGVEQFRSALEM
APQNHSAYFGLASALLAWARQCVMTGAFGWAASLLKEACKAAKVCTSLTGNLSCVWKLHG
DAQLALARCFPWGDGNIKGGMDDGTFRTTVLEWRNTCLLAANGAKFSYQRALHLTPWEAN
IHNDTAICLDLIYTIEENNSLDPITWELPEKMSLGGLILEPVNKDFWVTLGSVSSNQALK
QHSFIRALHLDMSLSEAWAYLGKIYRHSGDKQLARQAFDRARSIDPSLALPWAGMSAENY
HQPGDGPVNECFESCLRAVQILPLPEFQIGLGTIAARSGELLSPQVLMAVRQAVQRAPHY
PESHNINGLVSEVRSDFQSAIASYRQAKFALDMMRNSKTDCRCHIADISVNLARSLCKTG
LATEAVRECEELKRQGFLNDDGLQIYALSLWKLGRHDEALSVSRNLAENLSSMKQESATA
ALGFICTLTYNISGKDSAAAVIHKLPGQLNYSTQLKFIISALDALQPNKRFQLPQLSMPP
RLTSYEVMSEVHSNIALGNAIGGESDKFLRVDGGLSYLKKVLHMYPDCSLVRNQLGSLLL
SSEDWMASHKAVRVTSLSRGYTSNRGLRSPHQIQACAAVSCYATCTSYPKFSFPTCEDQY
LSGYNAICRLQRWVHLEPWNQDARRLLVLTLFQKAREEKYPKHICTILKRLILQVLSSGS
NSQDNKVVQYGNYLLLLVASEVSLQSGDHGNCIAQATEALGVTSSSVDSFFAHLQLCRAY
VMQGNLLNSRSEYMKCLQNRTDTEIGWVILKQLASICSLEGTPDEIEIHLGGCVERKGSN
ASKWMSLFYLACAQCSVWNEDFASAEKAIAQACAEGDPDSCVLFLNGAICMDIAWRFAAP
QFIARAASSLRKAQQKSLASLPIVSLLLAQAEGSLGSKAKWEKNLRLEWFSWPPELRPAE
LYFQMHLLATQSSAATSQQNQLVETMQTPEKWLLRAIHLNPSCSRYWTALMQLLNSFGAA
AVLAFSTTVPLSDIAFALLVIPYLVVLSVLAFPQRPGKPNPGAPVFLGRGRFLLRAHDAL
GFLVGAALPALYILDGLRSGDTAGVAAASPHAFLLAAQIFTEGLAAAWPGRFSLPVRAAV
VVMYGARRMFAASEWLRQEMEKRDQFGGGVGGAPAVARRRVVAGRVLAVANLAYWGINLF
AFLLPFYLPKAFNRYYCGSDSKEDDATAAAGAIDADDAKKKDS
NT seq 4272 nt   +upstreamnt  +downstreamnt
atgcctgaaaaggcggcggaggccaacctccgcaagcagctggagcaaaccctcgccggc
gagccatccagcccgctccaccactacaacctcggcgtcttcctatgggaccgcgcggag
gcggcggcgagggaggagggcgaggaggaggaggaggtgaggcggctccgtgcggcggcg
gccgagcgcttcctcgcggcggccaagctggaccccaacgacggcgtccccttccgcttc
ctcggccaccattatgcgcttgccggcgacgcgcagcgagcggccaagtgctatcagcgg
gcggcgacgctcaaccctgatgatgccgaggctggggaggcggtctgtgatttgctagat
ttggagggcaaggaaagcttggagatcgctttgtgcaaggaggcagctggcaagtcaccc
cgggcattttgggcgttccggaggttggggtacttacaggttcatcagaagaaatggtca
gaggctatacagagccttcagtatgcaatacgaggttacccaacatgtgcagatttatgg
gaagcactcggtctggcataccaccgtttgggcatgtttactgcagcagtaaagtcgtat
gggcgagctgttgaactggatggttccaaggtctttgcgttgatagaaagtggaaacatc
cagctaatgcttggttattttagaaagggtgttgaacagttccgctctgccttggagatg
gctcctcaaaatcattccgcgtactttggtcttgcttctgcattgcttgcttgggcaagg
cagtgtgtaatgactggggcctttggctgggcagctagtctgttgaaggaagcatgcaaa
gctgccaaagtttgtacttctttgactggaaacctttcctgtgtttggaaactgcatgga
gatgctcagctcgcacttgcaagatgctttccatggggtgatggtaatatcaaggggggt
atggatgatggtactttcaggactactgtacttgagtggagaaatacatgtttgttggct
gcaaatggtgcaaaattctcataccaacgagctttgcatctcactccctgggaagctaat
attcacaatgacactgctatatgtcttgatctcatttataccattgaggagaataatagt
ctagatcccataacttgggaactgccagagaaaatgtcgttgggtgggttgatactggaa
ccagtcaataaggatttttgggttacattgggctcggtgtcaagtaatcaagctttaaaa
cagcattcttttatcagagcactgcatcttgatatgtctctctctgaagcttgggcatac
cttggaaagatttacaggcattcaggtgataagcagttggcaagacaagcatttgatcga
gctcgaagcattgatccttcactggccttgccatgggcaggaatgtcagctgaaaattac
caccagcctggggatgggccagtaaatgaatgttttgaaagctgcttgcgggctgtgcag
atacttcctcttccagagttccagattggtcttggaacaattgctgctcgttctggtgaa
cttctatcacctcaggtattgatggctgtaaggcaagctgttcaacgggcacctcattac
cctgagtcgcacaacataaatggcttggtttctgaagtgcgatcagacttccaatctgca
attgcatcgtaccgacaagcaaaatttgctttagatatgatgcgcaactccaaaacagac
tgcagatgtcatattgctgatatttccgtgaatcttgcccggtcactatgtaagactggt
cttgcaactgaggcagtgcgggagtgcgaagaattgaaaagacaaggatttctgaatgat
gacggattgcagatatatgctctttcattatggaaacttggtcggcatgatgaagctctt
tcagtatcaagaaacttggctgaaaacttatcgagtatgaagcaggagagtgcaactgca
gctttaggattcatatgcacgttgacatacaacatctctgggaaggactctgcagctgcg
gtcattcataaactgcctggtcaactcaattacagcacacagctgaaatttattatctct
gcattagatgctttacagccaaacaagcgttttcagttaccccagctgagtatgcctcct
aggcttacatcgtatgaagtcatgagtgaagtccactcaaatattgctcttggaaatgct
attggtggggaatcagacaagtttttaagggttgatggtggcctgtcttacctgaaaaag
gttctacacatgtatcccgactgcagtttagtaagaaaccaacttggatctctgctactg
tcaagtgaagattggatggcttctcataaagcagtaagggttacttcattgtcccgggga
tatacatccaataggggcttaagatctccacaccaaattcaagcatgtgcagcagtttct
tgctatgctacctgcacttcttacccaaagttctcttttccaacatgtgaagatcaatac
ctaagcggatacaatgcaatatgccgcctgcaaaggtgggttcatctagaaccgtggaac
caagatgcacgtcgcctccttgtacttacccttttccaaaaagcacgtgaagaaaagtat
ccgaaacatatctgcaccattttgaagaggctgattttgcaagttctctccagtggtagc
aattcacaagacaataaggtggttcagtatgggaactacttgttacttcttgtggcttca
gaggttagtttgcaatctggtgaccatggcaactgtattgctcaagctactgaagctctt
ggagtaacttcttcgagcgtggattctttctttgcacacttgcaactgtgtcgggcctat
gtgatgcaaggcaatcttttgaactctaggagtgagtacatgaaatgcctgcaaaaccgt
acagatactgaaattggctgggtaatacttaagcaacttgcatctatatgttcactggag
ggtacccctgatgaaatagagatacatctcggaggatgcgttgaaaggaaaggtagcaat
gcatccaaatggatgtctcttttttatctagcatgcgctcagtgttcagtatggaatgag
gactttgcaagtgctgaaaaagctattgctcaggcatgtgctgaaggggatcctgacagc
tgtgtcttatttctcaacggcgcaatttgtatggacattgcttggaggttcgcggcccct
caatttatagcccgtgcagcttccagcctcagaaaggcacagcagaaatcacttgcttct
ttacctattgtgtccctcttactggcccaagcagaaggcagccttggctccaaagccaag
tgggagaaaaaccttcgtctagagtggttctcatggcccccagaattgaggcctgctgag
ctctatttccagatgcatcttctggcaacgcagtcaagtgcagcaacttcccagcagaac
cagctagtggaaaccatgcaaaccccagagaagtggcttctcagggcgatacacctgaac
ccgtcgtgctctaggtactggacggctctgatgcaactcctcaactcgttcggcgccgcg
gccgtgctcgccttctccaccaccgtgccactctccgacatcgccttcgccctcctcgtc
atcccttacctcgtcgtcctctccgtcctcgccttcccgcagaggcccggcaagcccaac
ccgggcgcgccggtcttcctcggccgcggccgcttcctcctcagggcccacgacgcgctc
ggcttcctcgtcggcgccgcgctcccggcgctctacatcctcgacggcctccgctcgggc
gacacggcgggcgtcgccgcggcgtccccgcacgcgttcctcctcgccgcgcagatcttt
accgagggcctcgccgcggcgtggcccgggaggttctccctccccgtgcgtgccgccgtg
gtggtgatgtacggcgcgcggaggatgttcgcggcgtcggagtggctccgccaggagatg
gagaagcgggaccagttcggcggcggcgtcggcggcgcgcccgccgtggcgcgccgcagg
gtggtggcggggagggtgctggcggtggcgaacctcgcctactgggggatcaacctcttc
gccttcctgctgccgttctacctgcccaaggcgttcaacaggtactactgcggcagcgac
agcaaggaggacgacgccaccgccgccgccggcgccattgacgccgacgacgccaagaag
aaggattcctag

DBGET integrated database retrieval system