KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349318
Entry
4349318           CDS       T01015                                 
Name
(RefSeq) proline dehydrogenase 2, mitochondrial
  KO
K00318  proline dehydrogenase [EC:1.5.5.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4349318
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     4349318
SSDB
Motif
Pfam: Pro_dh SepSecS
Other DBs
NCBI-GeneID: 4349318
NCBI-ProteinID: XP_015612712
UniProt: Q336U3 Q0IVV7
LinkDB
Position
10:21617956..21620591
AA seq 490 aa
MAIASRIQKRVLASFAAAAAAKLPEAAVAAAGGAAEAVEEVASSVQEQVQAQGAQVLEFG
DTERLFAGERSTSLVRTLAVLQALSVGPLVDVATAALRSPAVAGSAAGRAAARATAYQHF
CAGETAEEAAAAVRRLWRGGMGGILDYGIEDAEDGPACDRNAAGFLAAIDVAAALPPGSA
SVCIKITALCPVALLEKASDLLRWQQKHPATKLPWKVHGFPVLCVSSPLYLTAAEPPALE
AEEERELEMAHGRLLAIGERCAEYDIPLLVDAEYATVQPAIDYFTFAGALAFNGGGRPIV
HGTVQAYLRDARDRLEAMARAAQGERVCLALKLVRGAYLAREARLAASLGVPSPVHRSIQ
DTHDCYNGCAAFLLDRVRRGAAAVTLATHNVESGQLAAARALELGIGGGGDRGLQFAQLM
GMADGLSLGLRNAGFQVSKYLPYGPVEQIIPYLIRRAEENRGLLSSSSFDRQLLRKELVR
RFKAAMLGRE
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggccatcgcctcccgcatccagaagcgcgtgcttgcctccttcgccgccgccgccgca
gccaagctcccggaggcggccgtcgcggccgccggaggcgccgcagaggcggtggaggag
gtcgcgtcttccgtgcaggagcaggtgcaggcgcagggagcgcaggtgttggagtttggg
gataccgagaggctgttcgccggggagaggtcgacgtcgctggtgcgcacgctcgccgtg
ctgcaggcgctgtcggtgggcccgctcgtggacgtggcgacggcggcgctgaggtcgccg
gcggtggccgggagcgcggcggggcgcgccgcggcgagggccaccgcgtaccagcacttc
tgcgccggggagaccgccgaggaggccgccgcggcggtgcgccgcctctggcgcggcggc
atgggcgggatcctcgactacggcatcgaggacgccgaggacggccccgcctgcgaccgc
aacgccgccggattcctcgccgccatcgacgtcgccgccgcgctgcctcctggctcggcg
agcgtgtgcatcaagatcacggcgctgtgcccggtcgcgttgctggagaaggcgagtgat
ctgctgcggtggcagcagaagcacccggcgacgaagctgccatggaaagtgcacgggttc
ccggtgctgtgcgtctccagcccgctgtacctgacggcggcggagccgccggcgctggag
gcggaggaggagagggagctcgagatggcgcacgggcggctgctggcgatcggcgagcgg
tgcgcggagtacgacatcccgctgctggtggacgccgagtacgccaccgtgcagccggcg
atcgactacttcacgttcgccggcgcgctggcgttcaacggcggcgggaggcccatcgtg
cacggcaccgtccaggcctacctccgcgacgcgcgcgaccggctggaggccatggcgcga
gcggcgcagggcgagcgcgtgtgcctcgcgctcaagctggtccgcggcgcgtacctggcg
cgcgaggcccgcctcgcggcctccctcggcgtgccgtcgccggtccaccgcagcatccag
gacacccacgactgctacaacggctgcgccgcgttcctcctcgaccgcgtccgccgcggc
gccgccgccgtgacgctcgccacgcacaacgtcgagtccgggcagctcgccgcggcgagg
gcgctggagctcggcatcggcggcggcggcgaccgcggcctgcagttcgcgcagctgatg
ggcatggcggatggcctctcgctcggcctccgcaacgccgggttccaggtgagcaagtac
ctgccgtacggtccagtggagcagatcatcccgtacctcatcagacgagcagaggagaac
aggggattgctctcgtcttcctccttcgacagacagctgctccggaaggagcttgtgagg
aggttcaaggctgcaatgctgggacgtgagtga

DBGET integrated database retrieval system