KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349653
Entry
4349653           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S16
  KO
K02960  small subunit ribosomal protein S16e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349653
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4349653
SSDB
Motif
Pfam: Ribosomal_S9 DUF2102 DUF463
Other DBs
NCBI-GeneID: 4349653
NCBI-ProteinID: XP_015617880
UniProt: Q0IQF7
LinkDB
Position
11:complement(1285451..1286285)
AA seq 149 aa
MAAALTRPPPGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPILL
AGRSRFKDIDMRIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEASKKEVKDIFARYDR
TLLVADPRRCEPKKFGGRGARARFQKSYR
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgccgcgctcacccgcccgccgccaggcacggtccagtgcttcgggcgcaagaag
acggcggtggccgtctcctactgcaagccggggcgcgggctgatcaaggtgaacggcgtc
ccgatcgagctgatcaggccggagatgctccgcctcaaggcgttcgagcccatcctgctc
gcggggaggtcacgcttcaaggacatcgacatgaggatccgcgtccgcggcggagggaag
acgtcgcagatctacgcgatccgccaggccatcgccaaggccctcgtcgcctactaccag
aagtacgtcgacgaggcatccaagaaggaggtcaaggacatctttgcccgctatgaccgc
actctactcgtcgccgaccccaggcgctgcgagcccaagaagttcggtggtcgcggcgcc
cgcgccaggttccagaagtcgtaccgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351374
Entry
4351374           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S16
  KO
K02960  small subunit ribosomal protein S16e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4351374
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4351374
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4351374
SSDB
Motif
Pfam: Ribosomal_S9 DUF2102 DUF463
Other DBs
NCBI-GeneID: 4351374
NCBI-ProteinID: XP_015620704
UniProt: Q0IQF7
LinkDB
Position
12:complement(1169650..1170470)
AA seq 149 aa
MAAALTRPPPGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPILL
AGRSRFKDIDMRIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEASKKEVKDIFARYDR
TLLVADPRRCEPKKFGGRGARARFQKSYR
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgccgcgctcacccgcccgcctccaggcacggtccagtgcttcgggcgcaagaag
acggcggtggccgtctcctactgcaagccggggcgcgggctgatcaaggtgaacggcgtc
ccgatcgagctgatcaggccggagatgctccgcctcaaggcgttcgagcccatcctgctc
gcggggcgctcgcgcttcaaggacatcgacatgaggatccgcgtccgcggcggtgggaag
acgtcgcagatctacgcgatccgccaggccatcgccaaggccctcgtcgcctactaccag
aagtacgtcgacgaggcgtccaagaaggaggtcaaggacatctttgcccgctacgaccgc
accctcctcgtcgccgaccccaggcgctgcgagcccaagaagttcggtggtcgcggcgcc
cgcgcaaggttccagaagtcgtaccgctga

DBGET integrated database retrieval system