KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349811
Entry
4349811           CDS       T01015                                 
Name
(RefSeq) ribonuclease H2 subunit A
  KO
K10743  ribonuclease H2 subunit A [EC:3.1.26.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4349811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4349811
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     4349811
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    4349811
SSDB
Motif
Pfam: RNase_HII LPD29
Other DBs
NCBI-GeneID: 4349811
NCBI-ProteinID: XP_015615681
UniProt: A3C8R0 Q53QG3
LinkDB
Position
11:2529744..2532699
AA seq 298 aa
MVAAVAPEWATKEPCLMGIDEAGRGPVLGPMVYGCMYCARSYQDTLATLKFADSKTLKEE
QREELFESLKDNSSIGWEVDVICPKELSAKMLKRSKVNLNEISHNSAMGLVKRALDMGVL
LAEVYIDTVGDAEKYRIKLTEKFPGIKFVVAKKADSLFPVVSGASIVSKVTRDRALRNWV
FDETAQNMHMNTGSGYPGDPSTKQWLEDHKHPIFGFPSLVRFSWGTCTPFFNDAIEVTWE
SNELEEDAGSNGSVKRQVKLSSLGFTGFKRKSEEIDSSGKGRCKFFQARKLELVRKFQ
NT seq 897 nt   +upstreamnt  +downstreamnt
atggtggcagcggtggcgccggagtgggccaccaaggagccctgcctcatgggaatcgac
gaggctgggcgcggccccgttctcggtccaatggtgtatggctgcatgtactgcgctcgt
tcctaccaagacactcttgcaacccttaaatttgcagattcgaagaccttgaaggaagaa
caaagggaggagctgtttgaaagtctaaaagacaatagttcaattgggtgggaagtggat
gtcatatgcccaaaggagctatctgctaaaatgttaaaaagatcgaaagttaacctgaat
gaaatatctcataactctgcaatgggtctggtcaaaagagctcttgacatgggagttcta
ctagcagaggtctacattgatacggttggagatgcggagaagtacaggatcaaattgact
gaaaagttcccaggcatcaaatttgtggttgccaagaaggctgatagccttttcccagtt
gttagtggagcaagtatagtttcgaaggttaccagagacagagccttgagaaactgggta
tttgatgaaacggctcagaatatgcacatgaacactgggtctggttatccaggagatcct
tccactaaacaatggttagaagatcacaaacatccgatatttggattcccgtctttggtt
cgttttagctggggaacttgcacgcccttcttcaatgacgcaattgaagttacctgggag
tccaatgaacttgaagaagatgcaggtagcaacggtagtgttaagagacaggtcaagcta
tcaagcttaggctttactggattcaaaaggaagtctgaggagatcgactcaagtgggaaa
ggccgttgcaagttcttccaggctcgcaaacttgaacttgtcaggaagtttcagtga

DBGET integrated database retrieval system