KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349878
Entry
4349878           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L3-like isoform X1
  KO
K02925  large subunit ribosomal protein L3e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349878
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4349878
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 4349878
NCBI-ProteinID: XP_015617260
UniProt: Q0IUC6 Q53JG0
LinkDB
Position
11:3290798..3297023
AA seq 389 aa
MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVNKPCHLTSFVGYKAGMTHIVREV
EKPGSKLHKKETCEAVTIIETPPIVVVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYK
NWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASVVRVIVHTQIRKMKGLKQKKAH
LMEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACT
EFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL
KFIDTSSKFGHGRFQTTDEKQRFFGKLKA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtcgcacaggaagttcgagcacccgaggcacggatccctcggcttcctcccgaggaag
cgctcctcccgccaccgcggcaaggtgaagtcattccccaaggatgacgtcaacaaacca
tgccacctcacctcctttgtcggttacaaggctggaatgacccacattgtgcgtgaggtc
gagaagcctggttccaaactccacaagaaggagacctgtgaggctgttaccattattgag
acacctcctattgtcgttgttggacttgtggcctatgtgaagactccacgtggcttacgc
agtctcaactctgtctgggctcagcatcttagtgaagaagtaaggagaaggttctacaag
aactggtgcaagagcaagaagaaggctttcaccaagtatgctctcaagtatgatagcgat
gccggcaagaaggaaatccaaatgcagcttgagaagatgaagaagtatgcttctgttgtc
cgtgtgatcgtgcacactcagattaggaaaatgaagggcttgaagcagaagaaggctcac
ctcatggagatccagatcaatggtggtaccattgccgataaggtggactatggatacaag
ttctttgagaaggagatcccagttgatgctgtgttccagaaggacgagatgattgacatc
attggtgtcaccaagggtaagggttatgaaggtgttgtcacgcgttggggtgtcactcgc
cttccccgcaagacccacaggggtctccgcaaggtcgcctgtatcggtgcctggcatcct
gctagggtttcctatactgttgctcgcgctggtcagaatgggtaccaccaccgcactgag
atgaataagaaggtttacaagatcggcaagtctggccaggaaagccatgctgcctgcact
gaatttgacaggactgagaaggacatcactcccatgggtggcttccctcactacggtgtt
gtgaagggcgactacctcatgatcaagggttgctgtgttggccccaagaagagggtcgtc
accctccgccagtccctgctcaagcagacctctcgtttggcgctcgaggagatcaagctc
aagttcatcgacacctcgtccaagttcgggcacggtcgcttccagaccaccgacgagaaa
cagaggttcttcggcaagctcaaggcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351604
Entry
4351604           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L3
  KO
K02925  large subunit ribosomal protein L3e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4351604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4351604
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4351604
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 4351604
NCBI-ProteinID: XP_015619855
UniProt: P35684 Q0IPU6 A0A8J8YDM7
LinkDB
Position
12:3429135..3431766
AA seq 389 aa
MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREV
EKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYK
NWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAH
LMEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACT
EFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL
KFIDTSSKFGHGRFQTTDEKQRFFGKLKA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtcgcacaggaagttcgagcacccgaggcatggatccctcggcttcctcccgaggaag
cgctcctcccgccaccgcggcaaggtgaagtccttccccaaggatgacgtatcaaagccc
tgccaccttacttccttcgttggctacaaggctggaatgacacacattgtgcgtgaggtc
gagaagcctggctccaagctccacaagaaggaaacctgcgaggctgttaccatcatcgag
acccctccgcttgtcattgttggactcgtggcctatgtcaagacacctcgtggacttcgc
tctctcaactctgtctgggcccagcaccttagcgaggaggtgcggagaaggttctacaag
aactggtgcaaaagcaagaagaaggctttcactaagtatgcccttaagtatgacagtgat
gctggcaagaaagaaatccagatgcaacttgagaagatgaagaagtacgcatctattgtt
cgtgttattgcccacactcagatcagaaagatgaagggcttgaagcagaagaaggctcac
ctcatggagatccagatcaacggtggcactatcgccgacaaggtggactatggctacaag
ttctttgagaaggaaatccctgttgatgcagtcttccagaaggacgagatgattgacatc
attggtgtcactaagggtaagggttatgaaggtgtcgtcactcgttggggtgtcacccgc
cttcctcgcaagacccacaggggtctccgcaaggttgcttgtattggtgcctggcatcca
gccagggtgtcctacactgttgcccgtgctggtcagaacggataccaccaccgcactgag
atgaacaagaaggtttacaagattggcaagtctggtcaggagtctcatgcggcctgcacc
gagttcgacaggactgagaaggacatcaccccgatgggcggcttcccgcactacggtgtg
gtgaagggcgactacctcatgatcaagggttgctgcgtcggtccgaagaagagagtcgtc
accctccgccagtcgctgctgaagcagacctcgcggctcgccctggaggagatcaagctc
aagttcatcgacacctcgtccaagttcgggcacggtcgcttccagaccaccgacgagaag
cagaggttcttcggcaagctcaaggcctag

DBGET integrated database retrieval system